BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0491 (789 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 24 1.6 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 22 4.9 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 8.5 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 23.8 bits (49), Expect = 1.6 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +1 Query: 82 VVSALQVGVADRFADVRGAAEVDDLDPVRLPSRLHQHYVLRLQVRVDQAELLSNEIKHVK 261 +V A Q + D A+VR AA D + + HQ ++ + EL+++ +HVK Sbjct: 285 LVPAFQNLLKDTEAEVRAAAANKVKDFCQNLDKAHQESIIMNNILPCVKELVADPNQHVK 344 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 568 RKVFHPAFTQS 536 RK FHPA TQS Sbjct: 255 RKPFHPASTQS 265 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.4 bits (43), Expect = 8.5 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 204 PENIM-LVEPARQPYRVKVIDFGSASHVSKAVCNTYL 97 P N++ L P +P +ID G A + +CN YL Sbjct: 140 PGNVLNLTMPKYEP-NPSIIDPGPALPPAGFLCNNYL 175 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,638 Number of Sequences: 336 Number of extensions: 3158 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -