Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0490
         (797 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF237761-2|AAF81411.1|  908|Drosophila melanogaster unknown prot...    30   4.2  

>AF237761-2|AAF81411.1|  908|Drosophila melanogaster unknown
           protein.
          Length = 908

 Score = 29.9 bits (64), Expect = 4.2
 Identities = 10/31 (32%), Positives = 22/31 (70%)
 Frame = +1

Query: 553 RMRHYSWQVKSTRSVTLPYYGLIRTRIQGRK 645
           R+ H   Q+K  +++  PY+GL+++ ++GR+
Sbjct: 591 RVWHIGLQLKIKQTLPAPYFGLLKSYLEGRR 621


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,122,925
Number of Sequences: 53049
Number of extensions: 579168
Number of successful extensions: 1094
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1085
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1094
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3716337612
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)