BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0489 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 23 3.5 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 23 3.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.1 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 6.1 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 225 LDKLKAERERGITIDIALWKFETSKYYVTII 317 L KLK + G + +A KF K+YV I+ Sbjct: 78 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 108 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 225 LDKLKAERERGITIDIALWKFETSKYYVTII 317 L KLK + G + +A KF K+YV I+ Sbjct: 4 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 34 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.1 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 617 ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 489 +S ++ + N L V FLL K L + W G+ +YDE Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.1 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 617 ESDSSWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 489 +S ++ + N L V FLL K L + W G+ +YDE Sbjct: 1267 QSVFAFFMMNALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 4/25 (16%) Frame = -1 Query: 756 QNGIESFNEAFSVSF----AFLTLH 694 +N ++ FN+ F +SF ++ TLH Sbjct: 190 KNTVDDFNDIFGISFLLIISYSTLH 214 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,755 Number of Sequences: 336 Number of extensions: 4118 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -