BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0489 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 26 1.4 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 4.4 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.7 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 25.8 bits (54), Expect = 1.4 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 605 SWVVANLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 489 ++V+AN L V FLL K L + W+ + S+DE Sbjct: 927 AFVMANALFVLVIFLLQLKKQELHIEWWFNVKNKISFDE 965 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.2 bits (50), Expect = 4.4 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 4/55 (7%) Frame = +1 Query: 505 TKWIPLNHHTVSPDLRKSRRK----YPHTSRRLATTQLLSLSCPFLDGTGDNMLE 657 T ++ L+HH + PD+ K+ + + T AT +L+++S + G N+ + Sbjct: 822 TLFMALDHHDMDPDMEKALKSGNYFFTATFAIEATMKLIAMSPKYYFQEGWNIFD 876 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 Query: 525 PPYSEPRFEEIKKEVSSYIKKIGYNPAAVAF 617 PP+S +KK+ Y+++ N +A F Sbjct: 333 PPWSNRTLRNLKKDRMKYLRRYRLNRSAFNF 363 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 828,984 Number of Sequences: 2352 Number of extensions: 18851 Number of successful extensions: 26 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -