BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0485 (799 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 26 1.2 CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein ... 25 3.6 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 476 HLETLLLCSPHKAILFCRNPFFG 408 +L+ L CSP K + FCR PF G Sbjct: 147 NLDCLSKCSPTKCVPFCR-PFSG 168 >CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein protein. Length = 207 Score = 24.6 bits (51), Expect = 3.6 Identities = 19/55 (34%), Positives = 22/55 (40%) Frame = -1 Query: 301 RSEPG*GKGVTAVNTTTRRRSSPQGRPADGAFEAARQAAQTVPLVYRNTPLDQNQ 137 R P G T T +RR P R G AAR +TV L N QN+ Sbjct: 25 RKRPEKSNGSTVKKTIRKRR--PALRSTSGVLRAARPERRTVLLDACNVSHYQNR 77 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,504 Number of Sequences: 2352 Number of extensions: 17103 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -