BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0484 (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 0.57 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 7.0 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 7.0 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.4 bits (53), Expect = 0.57 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = -2 Query: 589 YNTNRTIFMKKKMEFSLPKTILKHNKNNIK 500 Y TNR++F++++ E + +L+H K + Sbjct: 131 YPTNRSLFIREQTEEMYREMLLEHKKRRAR 160 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 307 NTKTYQKTKREHFT*NPTIAFF 242 N K Y K + F PTI +F Sbjct: 13 NPKLYDKHRAPKFLGQPTIVYF 34 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 739 LSKCSTECSLILRWSTESAVRTTT 668 L +C+T RW S + TTT Sbjct: 768 LLQCATSNYSTTRWPATSVITTTT 791 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,407 Number of Sequences: 438 Number of extensions: 4194 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -