BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0482 (643 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schi... 27 2.3 SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces ... 26 4.0 SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces p... 25 9.3 >SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1568 Score = 27.1 bits (57), Expect = 2.3 Identities = 14/43 (32%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +3 Query: 159 IRTYSSTKWRRFTRFCSQMILFNFSLFHENMIKIYL-FSILIR 284 ++ YSST+ S+++L+ F+ F EN++K+ + SI +R Sbjct: 422 VQLYSSTESDLLKEGLSRILLYFFTYFPENILKLKIDTSIFLR 464 >SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces pombe|chr 1|||Manual Length = 1213 Score = 26.2 bits (55), Expect = 4.0 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 627 QNYFYQYDGQIL-MNSHYHSYVMFCYHHYDVNPLHQIF 517 Q+Y Y+ D QI+ + + YH Y+M HH P F Sbjct: 848 QSYHYE-DCQIMDVRNDYHLYIMTWLHHSWTLPYRDYF 884 >SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 2280 Score = 25.0 bits (52), Expect = 9.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 609 YDGQILMNSHYHSYVMFCYHH 547 YD QI++NS Y+ +V +H Sbjct: 826 YDNQIILNSTYNEFVEVLRNH 846 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,155,241 Number of Sequences: 5004 Number of extensions: 38064 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -