BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0482 (643 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0124 - 13085820-13085997,13086235-13086362,13086475-130865... 28 7.2 09_04_0276 - 16306894-16307526,16307556-16308572 27 9.6 >10_07_0124 - 13085820-13085997,13086235-13086362,13086475-13086550, 13086726-13086803,13086985-13087064,13087411-13087480, 13087730-13087887,13088225-13088315,13088379-13088455, 13088612-13088686,13088798-13089071,13089911-13090041, 13090154-13090323,13090413-13090971,13091077-13091127 Length = 731 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 627 QNYFYQYDGQILMNSHYHSYVMFCYHHYDVNPL 529 +NYF+++DG I S + + C H+ V PL Sbjct: 377 RNYFFKHDGTI--TSFISALKLACSKHFSVEPL 407 >09_04_0276 - 16306894-16307526,16307556-16308572 Length = 549 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 411 WNHFQIHLWNPSGAFW*LFKKFTVTRIILAQ 319 +N+ I LW+P GA+W +K VT + A+ Sbjct: 114 YNYTDI-LWSPYGAYWRQARKMCVTELFSAR 143 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,347,585 Number of Sequences: 37544 Number of extensions: 189009 Number of successful extensions: 383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -