BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0482 (643 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC030780-1|AAH30780.1| 328|Homo sapiens coiled-coil domain cont... 30 8.0 AK058091-1|BAB71661.1| 328|Homo sapiens protein ( Homo sapiens ... 30 8.0 AF367469-1|AAK53405.1| 328|Homo sapiens testes development-rela... 30 8.0 >BC030780-1|AAH30780.1| 328|Homo sapiens coiled-coil domain containing 54 protein. Length = 328 Score = 29.9 bits (64), Expect = 8.0 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +1 Query: 391 MNLKVIPQVKKEIKVTPANQALEAKVKVALVPQVQDHTDLHQKNL 525 MNL V+ Q K +V +Q + V ++P+VQ+ TDL+QK + Sbjct: 64 MNLPVVLQDVKTAQVELFSQMTDI---VHMIPKVQEKTDLYQKQM 105 >AK058091-1|BAB71661.1| 328|Homo sapiens protein ( Homo sapiens cDNA FLJ25362 fis, clone TST01724. ). Length = 328 Score = 29.9 bits (64), Expect = 8.0 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +1 Query: 391 MNLKVIPQVKKEIKVTPANQALEAKVKVALVPQVQDHTDLHQKNL 525 MNL V+ Q K +V +Q + V ++P+VQ+ TDL+QK + Sbjct: 64 MNLPVVLQDVKTAQVELFSQMTDI---VHMIPKVQEKTDLYQKQM 105 >AF367469-1|AAK53405.1| 328|Homo sapiens testes development-related NYD-SP17 protein. Length = 328 Score = 29.9 bits (64), Expect = 8.0 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +1 Query: 391 MNLKVIPQVKKEIKVTPANQALEAKVKVALVPQVQDHTDLHQKNL 525 MNL V+ Q K +V +Q + V ++P+VQ+ TDL+QK + Sbjct: 64 MNLPVVLQDVKTAQVELFSQMTDI---VHMIPKVQEKTDLYQKQM 105 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,814,702 Number of Sequences: 237096 Number of extensions: 1241120 Number of successful extensions: 6369 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6368 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7085195460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -