BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0478 (785 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 26 0.35 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 26 0.35 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 25 0.60 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 24 1.4 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 2.4 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 5.6 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 22 5.6 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 22 5.6 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 22 5.6 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 22 5.6 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 22 5.6 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 22 5.6 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 22 5.6 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 22 5.6 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.6 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 7.4 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 7.4 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 9.8 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 9.8 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 9.8 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 9.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 9.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 9.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 9.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 9.8 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 9.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 9.8 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 26.2 bits (55), Expect = 0.35 Identities = 20/62 (32%), Positives = 30/62 (48%) Frame = +1 Query: 94 RKNRNVNKFAQRKRDRKEQEKNPQEKPNGDNRKAYEDIVRENAAFEEYYKMQKICPEEQW 273 RK R +K R RDR E+E++ + K N Y++ + + YY + I EQ Sbjct: 279 RKYRETSK--GRSRDRTERERSKETKIISSNNYNYKNYNNNYNSKKLYYNIINI---EQI 333 Query: 274 PV 279 PV Sbjct: 334 PV 335 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 26.2 bits (55), Expect = 0.35 Identities = 20/62 (32%), Positives = 30/62 (48%) Frame = +1 Query: 94 RKNRNVNKFAQRKRDRKEQEKNPQEKPNGDNRKAYEDIVRENAAFEEYYKMQKICPEEQW 273 RK R +K R RDR E+E++ + K N Y++ + + YY + I EQ Sbjct: 290 RKYRETSK--GRSRDRTERERSKETKIISSNNYNYKNYNNNYNSKKLYYNIINI---EQI 344 Query: 274 PV 279 PV Sbjct: 345 PV 346 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 25.4 bits (53), Expect = 0.60 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 576 ETPPCCRLCYKKVMKPIQCLVTPDIHTGEP*LPCK 472 E P C +C K ++ Q ++ HTGE CK Sbjct: 173 ERPHKCTVCSKTFIQSGQLVIHMRTHTGEKPYVCK 207 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 673 GLRPRGSTHVKHLMVRFHI*YYGRYHRH 590 G+ P G T + ++VR I Y+ H+H Sbjct: 85 GVGPNGLTKKQEMLVRSAIKYWVERHKH 112 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 543 SCSRDGSREESRDK 584 SCSRD SRE +D+ Sbjct: 252 SCSRDRSREYKKDR 265 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +3 Query: 99 KSERQQIRAKET*PQGAREKSTRETER 179 K+ER+ + +ET + +R+++ RE R Sbjct: 51 KNEREYRKYRETSKERSRDRTERERSR 77 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +3 Query: 99 KSERQQIRAKET*PQGAREKSTRETER 179 K+ER+ + +ET + +R+++ RE R Sbjct: 50 KNEREYRKYRETSKERSRDRTERERSR 76 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +3 Query: 99 KSERQQIRAKET*PQGAREKSTRETER 179 K+ER+ + +ET + +R+++ RE R Sbjct: 50 KNEREYRKYRETSKERSRDRAERERSR 76 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +3 Query: 99 KSERQQIRAKET*PQGAREKSTRETER 179 K+ER+ + +ET + +R+++ RE R Sbjct: 51 KNEREYRKYRETSKERSRDRTERERSR 77 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +3 Query: 99 KSERQQIRAKET*PQGAREKSTRETER 179 K+ER+ + +ET + +R+++ RE R Sbjct: 51 KNEREYRKYRETSKERSRDRTERERSR 77 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +3 Query: 99 KSERQQIRAKET*PQGAREKSTRETER 179 K+ER+ + +ET + +R+++ RE R Sbjct: 51 KNEREYRKYRETSKERSRDRTERERSR 77 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +3 Query: 99 KSERQQIRAKET*PQGAREKSTRETER 179 K+ER+ + +ET + +R+++ RE R Sbjct: 51 KNEREYRKYRETSKERSRDRTERERSR 77 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 22.2 bits (45), Expect = 5.6 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Frame = -1 Query: 659 GQHTCQAPYGEVSHLIL---REVSSTPVL 582 G + CQA G SHL L R S +P+L Sbjct: 32 GMNQCQAVNGHCSHLCLPAPRINSKSPLL 60 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 22.2 bits (45), Expect = 5.6 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 3/29 (10%) Frame = -1 Query: 659 GQHTCQAPYGEVSHLIL---REVSSTPVL 582 G + CQA G SHL L R S +P+L Sbjct: 32 GMNQCQAVNGHCSHLCLPAPRINSKSPLL 60 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +1 Query: 445 VNLPWYPGGFAWQLRLTRMDIRRNEAL 525 ++LPW G W R R EAL Sbjct: 132 IDLPWRTCGNPWNTRYCLTPTERLEAL 158 Score = 21.4 bits (43), Expect = 9.8 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -1 Query: 647 CQAPYGEVSHLILRE 603 C P G +SH +L++ Sbjct: 168 CSTPIGNLSHALLKD 182 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +1 Query: 445 VNLPWYPGGFAWQLRLTRMDIRRNEAL 525 ++LPW G W R R EAL Sbjct: 185 IDLPWRTCGNPWNTRYCLTPTERLEAL 211 Score = 21.4 bits (43), Expect = 9.8 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -1 Query: 647 CQAPYGEVSHLILRE 603 C P G +SH +L++ Sbjct: 221 CSTPIGNLSHALLKD 235 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/27 (29%), Positives = 19/27 (70%) Frame = +3 Query: 99 KSERQQIRAKET*PQGAREKSTRETER 179 K+ER+ + +ET + +++++ RET + Sbjct: 51 KNEREYRKYRETSKERSQDRTERETSK 77 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/27 (29%), Positives = 19/27 (70%) Frame = +3 Query: 99 KSERQQIRAKET*PQGAREKSTRETER 179 K+ER+ + +ET + +++++ RET + Sbjct: 51 KNEREYRKYRETSKERSQDRTERETSK 77 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 Query: 570 ESRDKNRCR*YL 605 E DKN+CR YL Sbjct: 567 EDADKNQCRHYL 578 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 3 SCSRDRSREYKKKDRR 18 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 3 SCSRDRSREYKKKDRR 18 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 3 SCSRDRSREYKKKDRR 18 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 3 SCSRDRSREYKKKDRR 18 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 3 SCSRDRSREYKKKDRR 18 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 3 SCSRDRSREYKKKDRR 18 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 3 SCSRDRSREYKKKDRR 18 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 252 SCSRDRSREYKKKDRR 267 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 252 SCSRDRSREYKKKDRR 267 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 252 SCSRDRSREYKKKDRR 267 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 252 SCSRDRSREYKKKDRR 267 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 252 SCSRDRSREYKKKDRR 267 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 252 SCSRDRSREYKKKDRR 267 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 543 SCSRDGSREESRDKNR 590 SCSRD SRE + R Sbjct: 252 SCSRDRSREYKKKDRR 267 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,456 Number of Sequences: 438 Number of extensions: 4444 Number of successful extensions: 51 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -