BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0471 (678 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 31 1.1 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_32481| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_24224| Best HMM Match : Lectin_C (HMM E-Value=0) 30 2.0 SB_53134| Best HMM Match : PAN (HMM E-Value=0.0002) 30 2.0 SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_287| Best HMM Match : Pentapeptide (HMM E-Value=0.1) 29 2.6 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 29 3.5 SB_4416| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_35554| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_59201| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_56201| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_53564| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_41611| Best HMM Match : Hep_Hag (HMM E-Value=2.9e-13) 28 8.0 SB_27609| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_24036| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_24035| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +1 Query: 112 TWSKATKTSQ--RKPIKLNRKRKCKEISSTQHGLHPPTKPTRVSRNRSSKAK 261 T +KA K ++ +KP +K K K+ SS + P+ PT SR + KAK Sbjct: 1897 TTAKALKKAKGKQKPGSATKKTKPKQDSSKKKRKRSPSPPTSASREGTRKAK 1948 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/72 (30%), Positives = 30/72 (41%) Frame = +2 Query: 362 SNPRTVSKLRPTIRESIPSAEPKLPRSGSKSVSRATEQFPEPKSGPVARPEPVWSEPT*L 541 SNP + P+ S PS+EP + S+S + P P S P P S Sbjct: 505 SNPSSDPSPNPS---SNPSSEPSPNPISNPSISTSPISNPHPSSNPSPHPSSNPSSEPSP 561 Query: 542 CPRAGPISESSP 577 P + P S+ SP Sbjct: 562 NPSSNPSSDPSP 573 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/59 (28%), Positives = 23/59 (38%) Frame = +2 Query: 401 RESIPSAEPKLPRSGSKSVSRATEQFPEPKSGPVARPEPVWSEPT*LCPRAGPISESSP 577 + S P + P + S + S P P S P P P S P + P S+ SP Sbjct: 455 KTSNPISNPSISTSPISNPSPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSP 513 >SB_32481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 29.9 bits (64), Expect = 2.0 Identities = 23/81 (28%), Positives = 32/81 (39%) Frame = -1 Query: 273 CYTDFGLGTAIATDSGRLGWRVEPMLCTADFLALAFAIEFDRLALACFCGFGPCQ*PHRL 94 CYT+ LGTA+ + +E FL I +R A+ + + Sbjct: 94 CYTE--LGTAVQKSGAEYAYLMEAFGPIPAFLFAWTGIIINRPAITAIVSLIFAEYVAKP 151 Query: 93 FFPECGEPFVVPTALSLC*LV 31 FFPEC P V L L +V Sbjct: 152 FFPECAPPPAVVKLLGLACIV 172 >SB_24224| Best HMM Match : Lectin_C (HMM E-Value=0) Length = 2726 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/69 (28%), Positives = 32/69 (46%) Frame = +2 Query: 311 PSYS*SNNSKPGQLWWVSNPRTVSKLRPTIRESIPSAEPKLPRSGSKSVSRATEQFPEPK 490 P YS +S Q ++S+P + S +P+ S P +EP+LP +S + T Q Sbjct: 967 PEYSSPPSSS--QSTFLSSPSSTSLQQPS-PSSQPHSEPRLPSPSLESSTLQTSQLSNDS 1023 Query: 491 SGPVARPEP 517 P+P Sbjct: 1024 PNSYTAPQP 1032 >SB_53134| Best HMM Match : PAN (HMM E-Value=0.0002) Length = 648 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +2 Query: 326 SNNSKPGQLWWVSN-PRTVSKLRPTIRESIPSAEPKLPRSGSKSVSRATEQFPEPK 490 S + KPGQL + ++ P+T+ +L+ T + S+E K + S +R +P+ K Sbjct: 563 SRSRKPGQLLFGNDLPKTLQELKTTNKIMNKSSEAKPFKRSSNMTARPGNNYPQNK 618 >SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2806 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/64 (21%), Positives = 29/64 (45%) Frame = +1 Query: 70 RFSTFRKK*SVGSLTWSKATKTSQRKPIKLNRKRKCKEISSTQHGLHPPTKPTRVSRNRS 249 + S ++++ S+ WS K +KP L + +K + + HG + T + + R Sbjct: 2517 QLSNYKRRWHKSSIAWSSFEKRQLQKPSSLQQSKKKDDPAGGSHGKNRSTSFSGEKKKRP 2576 Query: 250 SKAK 261 A+ Sbjct: 2577 KSAQ 2580 >SB_287| Best HMM Match : Pentapeptide (HMM E-Value=0.1) Length = 288 Score = 29.5 bits (63), Expect = 2.6 Identities = 31/156 (19%), Positives = 64/156 (41%), Gaps = 9/156 (5%) Frame = +1 Query: 109 LTWSKATKTSQRKPIKLNRKRKCKEISSTQHGLHPPTKPTRVSRNRSSKAKISITIML-- 282 +T ++ T+T+ ++ R R + + H TRV RNR ++ ++ T + Sbjct: 78 VTRTRVTRTNVTCT-RVTRTRVTRTYLTRSHVTRTQVTRTRVFRNRVTRTNVTRTRVTRT 136 Query: 283 -----IILLCPLERTQLQLVQQFQTRAAMVGLKPKDSFKTSPNNQGINSKR--RTKITTV 441 + RTQ+ + F+ R + +T + R RT+ T Sbjct: 137 RVTRTYLTRNHFPRTQVTRTRVFRNRVTRTNVTRTRFTRTRVTRTRVTRTRFTRTRFTRT 196 Query: 442 RLKISFKGNRTISRTKIRSSCKARTSME*TNLTMSK 549 R+ + ++RT++ + RT + T+LT ++ Sbjct: 197 RVTRTHLTRTRVTRTRVTRTHLTRTRVTRTHLTRTR 232 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 124 ATKTSQRKPIKLNRKRKCKEISSTQHGLHPPTKPTRVSRNRSSK 255 A +T RKP+ L R +E+ H + PTR+ + +S+ Sbjct: 175 AIQTPPRKPVNLTRSGSSEELLEKSTTSHKTSSPTRMFKRATSE 218 >SB_4416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 503 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 401 RESIPSAEPKLPRSGSKSVSRATEQFPEPKSGPVARPEPVWS 526 R +P+A P +P G ++ + + FP P +P+P S Sbjct: 215 RPVVPTARP-IPNGGEETTTATNQAFPRLPPPPAKKPKPAVS 255 >SB_35554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 464 Score = 28.7 bits (61), Expect = 4.6 Identities = 25/72 (34%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +2 Query: 365 NPRTVSKLRPTIRESIPSAEPKLPRSGSKSVSRATEQFPEPKSGPVARP-EPVWSEPT*L 541 NPR VS R ES P + P+ R K ++ E+FP P+ VAR S Sbjct: 287 NPRKVSGTR----ESCPKSHPRSFRDPRKLPEKSPEKFPGPEK--VARKVTREVSGTRES 340 Query: 542 CPRAGPISESSP 577 CP++ P S P Sbjct: 341 CPKSHPRSFRDP 352 >SB_59201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1326 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/74 (27%), Positives = 36/74 (48%) Frame = -1 Query: 579 IGLDSEIGPALGHS*VGSLHTGSGLATGPDFGSGNCSVALETDFEPDRGNFGSALGIDSL 400 +G+D+++ + + VG G+ T G V ++TD G +G+D+L Sbjct: 1221 VGVDTDVVTGVDNLVVGVETLVVGVDTDVVTGVDTLVVGVDTDVVT--GVDTLVVGVDTL 1278 Query: 399 IVGRSFETVLGFET 358 +VG + V+G ET Sbjct: 1279 VVGVDTDVVVGVET 1292 >SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = +2 Query: 407 SIPSAEPKLPRSGSKSVSRATEQFPEPKS--GPVARPEPVWSEPT*LCPRAGPISES 571 S+ P+LPR + S ++ P PK PV RP V + P + PRA ES Sbjct: 202 SVEPGLPQLPRPRTNSSNKKKSAPPLPKHVVSPVKRPNKVKAPPP-IPPRASESIES 257 >SB_56201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 27.9 bits (59), Expect = 8.0 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +2 Query: 308 VPSYS*SNNSKPGQLWWVSNPRTVSKLRPTIRESIPSAEPKLPRSGSKSVSRATEQFPE- 484 VP + SN G L + + + +R +RE + AE + P SGS S T P Sbjct: 541 VPPTTPSNTPIQG-LESIEDNMNLEAIRNALREDLTPAEGRPPSSGSSGRSTPTRWHPRT 599 Query: 485 PKSG 496 P SG Sbjct: 600 PGSG 603 >SB_53564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 7/60 (11%) Frame = +1 Query: 136 SQRKPIKLNRKR-------KCKEISSTQHGLHPPTKPTRVSRNRSSKAKISITIMLIILL 294 S++KP+K + R ++ S + GL+ KP + ++R + A I++ I L ++L Sbjct: 159 SRKKPVKSGKSRISSIQYTHSRQRSQSSCGLYKSVKPVQSGKSRFASAMIALPIKLQVVL 218 >SB_41611| Best HMM Match : Hep_Hag (HMM E-Value=2.9e-13) Length = 422 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/74 (27%), Positives = 34/74 (45%) Frame = -1 Query: 579 IGLDSEIGPALGHS*VGSLHTGSGLATGPDFGSGNCSVALETDFEPDRGNFGSALGIDSL 400 +G+D+++ + VG G+ T G V ++TD F +G+D+L Sbjct: 107 VGVDTDVVTGVETLVVGVETLVVGVDTDVVTGVDTLVVGVDTDVVTGVDTF--VVGVDTL 164 Query: 399 IVGRSFETVLGFET 358 +VG + V G ET Sbjct: 165 VVGVDTDVVTGVET 178 >SB_27609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -3 Query: 133 FLWLWTMSMTPPIIFSGMWRTFRGSNSAVVVLISTTKSMTS 11 FL++ S T PI++S +TFR + ++ + ST +S +S Sbjct: 634 FLFVLVNSCTNPILYSWRLKTFRNALKKLLGIKSTRQSSSS 674 >SB_24036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/74 (27%), Positives = 34/74 (45%) Frame = -1 Query: 579 IGLDSEIGPALGHS*VGSLHTGSGLATGPDFGSGNCSVALETDFEPDRGNFGSALGIDSL 400 +G+D+++ + VG G+ T G V ++TD F +G+D+L Sbjct: 765 VGVDTDVVTGVETLVVGVETLVVGVDTDVVTGVDTLVVGVDTDVVTGVDTF--VVGVDTL 822 Query: 399 IVGRSFETVLGFET 358 +VG + V G ET Sbjct: 823 VVGVDTDVVTGVET 836 >SB_24035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 902 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/74 (27%), Positives = 34/74 (45%) Frame = -1 Query: 579 IGLDSEIGPALGHS*VGSLHTGSGLATGPDFGSGNCSVALETDFEPDRGNFGSALGIDSL 400 +G+D+++ + VG G+ T G V ++TD F +G+D+L Sbjct: 572 VGVDTDVVTGVETLVVGVETLVVGVDTDVVTGVDTLVVGVDTDVVTGVDTF--VVGVDTL 629 Query: 399 IVGRSFETVLGFET 358 +VG + V G ET Sbjct: 630 VVGVDTDVVTGVET 643 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,826,386 Number of Sequences: 59808 Number of extensions: 395237 Number of successful extensions: 1542 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1520 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -