BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0470 (580 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58335| Best HMM Match : SMC_N (HMM E-Value=0.023) 29 3.6 SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 >SB_58335| Best HMM Match : SMC_N (HMM E-Value=0.023) Length = 354 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -3 Query: 401 QGGWRSYVVDVYGLQ*PLSTRWAASSSTHLRNKKNKKVVTA 279 +GGW SYV+ G Q PL R AA H ++ + V A Sbjct: 47 RGGWISYVITTAGPQ-PLEARSAAIDYEHYLTRQLQPVADA 86 >SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 565 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +2 Query: 440 LPHPFKPKRITASRQKSAGWWYLPARTQKRSYH 538 L HP K + R K+ WY P +TQ YH Sbjct: 136 LYHPTKTQANWYHRTKTQANWYHPTKTQANWYH 168 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,881,680 Number of Sequences: 59808 Number of extensions: 357809 Number of successful extensions: 621 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -