BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0464 (523 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 44 1e-04 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 44 1e-04 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 44 1e-04 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 44 1e-04 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 44 1e-04 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 44 1e-04 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 41 5e-04 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 40 0.001 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 39 0.002 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 27 7.1 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_50821| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 9 KRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 65 KRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 633 KRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 44 KRRPVNCNTTHYRANW 59 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 6 KRRPVNCNTTHYRANW 21 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 46 KRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 1884 KRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 44 KRRPVNCNTTHYRANW 59 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 6 KRRPVNCNTTHYRANW 21 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 38 KRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 87 KRRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 65 KRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 76 KRRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 52 KRRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 43.6 bits (98), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRANW 447 KRRPVNCNTTHYRANW Sbjct: 76 KRRPVNCNTTHYRANW 91 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 41.1 bits (92), Expect = 5e-04 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +3 Query: 426 TRGGARYPIRPIVSRITIHWPSF 494 T GGA PIRPIVSRITIHWP+F Sbjct: 34 TDGGA--PIRPIVSRITIHWPAF 54 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = +3 Query: 426 TRGGARYPIRPIVSRITIHWPSF 494 T GGA PIRPIVS ITIHWPSF Sbjct: 36 TVGGA--PIRPIVSHITIHWPSF 56 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRAN 450 KRRPVNCNTTHYRAN Sbjct: 83 KRRPVNCNTTHYRAN 97 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 494 KRRPVNCNTTHYRAN 450 KRRPVNCNTTHYRAN Sbjct: 26 KRRPVNCNTTHYRAN 40 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +3 Query: 450 IRPIVSRITIHWPSFLQR 503 IRPIVSRITIHWPSF +R Sbjct: 18 IRPIVSRITIHWPSFYKR 35 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.7 bits (71), Expect = 0.19 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +3 Query: 450 IRPIVSRITIHWPSF 494 +RP+VSRITIHW SF Sbjct: 33 LRPVVSRITIHWTSF 47 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 30.7 bits (66), Expect = 0.76 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 462 VSRITIHWPSFLQR 503 +SRITIHWPS LQR Sbjct: 277 LSRITIHWPSVLQR 290 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 456 PIVSRITIHWPSF 494 P +SRITIHWPSF Sbjct: 77 PYMSRITIHWPSF 89 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_16236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2317 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 116 EGITSCSKNQTRKIIISVITGGRTSCESARVGTTAPPIS 232 +G T+ ++ R +IT G T+ + GTTA P+S Sbjct: 1651 DGTTAVPRSMDRTTAAPMITDGTTAAPMSTDGTTAVPMS 1689 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +2 Query: 116 EGITSCSKNQTRKIIISVITGGRTSCESARVGTTAPPISAVKQ*CVSV*RVGQPL 280 +G T + R + + TGG T+ + GT A P+S V + R+ Q L Sbjct: 1212 QGTTVSPMSMDRTTAVPISTGGTTTAPRSTDGTAAAPMSTDGTTAVPIIRMEQLL 1266 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 465 SRITIHWPSF 494 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_50821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/40 (35%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = -2 Query: 285 SHNGCPTLQTETHYCFT---AEIGGAVVPTRADSQEVLPP 175 SH C +TE+ CFT E PT+ +S L P Sbjct: 32 SHRVCTPTKTESQSCFTPTKTESQSCFTPTKTESPSCLHP 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,474,374 Number of Sequences: 59808 Number of extensions: 367942 Number of successful extensions: 721 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -