BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0462 (485 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 0.79 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 1.8 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 2.4 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 2.4 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 24 3.2 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 23 5.6 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 5.6 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 5.6 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 23 7.3 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 7.3 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 7.3 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 7.3 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 7.3 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 23 7.3 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.8 bits (54), Expect = 0.79 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 131 NSSRTSRRRLQATL 90 NSSRT+ RRLQATL Sbjct: 350 NSSRTAIRRLQATL 363 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 1.8 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -3 Query: 441 RIRFPSKPDTPRSSEPILIPKLRIQFADFPYL 346 R+R + TP+ +++PKL+ + A P+L Sbjct: 5 RLRLITSFGTPQDKRTMVLPKLKDETAVMPFL 36 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 2.4 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 457 QTRHRPHPLPVQTRHAPVLRANPYSEVT 374 Q H PH Q +H P + P++ V+ Sbjct: 72 QLHHSPHQYHQQVQHQPQPPSTPFANVS 99 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 2.4 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 457 QTRHRPHPLPVQTRHAPVLRANPYSEVT 374 Q H PH Q +H P + P++ V+ Sbjct: 73 QLHHSPHQYHQQVQHQPQPPSTPFANVS 100 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.8 bits (49), Expect = 3.2 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 371 IRNFGIRIGSEDRGVSGLDGKRMRPVPGLVNNIK 472 I N I R VSGLD R P PG ++I+ Sbjct: 10 IGNLFIEPNRYRRIVSGLDSTRGSPAPGSRHSIR 43 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 23.0 bits (47), Expect = 5.6 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -3 Query: 261 PSPEFSRSAESIRTPPQMRCSSRSEPY 181 P P + + E PP++ C+ E Y Sbjct: 39 PEPSTTEATEEESPPPKIECTDPREVY 65 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 5.6 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -2 Query: 193 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 74 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 5.6 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -2 Query: 193 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 74 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 22.6 bits (46), Expect = 7.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 471 FILFTRPGTGRIRFPSKPDT 412 F++ RPG RIR SK T Sbjct: 531 FLVALRPGANRIRRRSKEST 550 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 22.6 bits (46), Expect = 7.3 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 169 RIPWNSNAQAEKKTLPGPLG 110 +IPW+ NA+A K G G Sbjct: 317 QIPWDRNAEALAKWASGQTG 336 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 7.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 409 PVLRANPYSEVTDPICRLPLPTLFYR 332 P L S + P CRLP P L R Sbjct: 89 PELVTRSLSNLELPSCRLPCPNLIPR 114 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 7.3 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 93 FGLPRRTLVFKDEGTI 46 FG+P++ + KD GT+ Sbjct: 1660 FGMPKQIVELKDTGTV 1675 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 7.3 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 93 FGLPRRTLVFKDEGTI 46 FG+P++ + KD GT+ Sbjct: 1661 FGMPKQIVELKDTGTV 1676 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 22.6 bits (46), Expect = 7.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 471 FILFTRPGTGRIRFPSKPDT 412 F++ RPG RIR SK T Sbjct: 531 FLVALRPGANRIRRRSKEST 550 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 560,750 Number of Sequences: 2352 Number of extensions: 12016 Number of successful extensions: 32 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42708759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -