BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0462 (485 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07220.1 68414.m00768 expressed protein 40 7e-04 At1g76965.1 68414.m08961 glycine-rich protein 29 1.3 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 2.2 At5g42370.1 68418.m05159 expressed protein 29 2.2 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 2.2 At2g19150.1 68415.m02235 pectinesterase family protein contains ... 29 2.2 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 2.9 At1g10390.1 68414.m01171 nucleoporin family protein contains Pfa... 28 3.8 At5g22390.1 68418.m02612 expressed protein 27 5.1 At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical... 27 5.1 At3g56510.1 68416.m06284 TBP-binding protein, putative similar t... 27 6.7 At2g05210.1 68415.m00549 expressed protein 27 6.7 At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase fa... 27 6.7 At2g03890.1 68415.m00351 phosphatidylinositol 3- and 4-kinase fa... 27 6.7 At1g75510.1 68414.m08774 transcription initiation factor IIF bet... 27 6.7 At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-P... 27 8.9 At3g02270.1 68416.m00208 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 27 8.9 At2g45570.1 68415.m05667 cytochrome P450 76C2, putative (CYP76C2... 27 8.9 At1g50410.1 68414.m05650 SNF2 domain-containing protein / helica... 27 8.9 >At1g07220.1 68414.m00768 expressed protein Length = 507 Score = 40.3 bits (90), Expect = 7e-04 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 1/88 (1%) Frame = -3 Query: 441 RIRFPSKPDTPRSSEPILIPKLRIQFADFP-YLHYSID*RLFTLETCCGYGYEPARHLHV 265 R+R P K +PRS +L+ L + F F L Y +D + +T G+ EP H+ Sbjct: 6 RLRLPHK-SSPRSPSYLLLCVLALSFFSFTALLFYKVDDFIAQTKTLAGHNLEPTPW-HI 63 Query: 264 HPSPEFSRSAESIRTPPQMRCSSRSEPY 181 P FS + + + ++CS S PY Sbjct: 64 FPRKSFSAATKHSQAYRILQCSYFSCPY 91 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 453 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 358 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -1 Query: 239 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 105 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 2.2 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 178 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 68 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 2.2 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +2 Query: 41 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 172 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At2g19150.1 68415.m02235 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 339 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 209 ICGGVRILSADLENSGEGCTWRCRAGSYPYPQQV 310 I GG+ + ++ EGCT + R G YP P +V Sbjct: 185 ISGGIDFIFGGAQSIFEGCTLKLRVGIYP-PNEV 217 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 234 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 136 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At1g10390.1 68414.m01171 nucleoporin family protein contains Pfam profiles: PF04096 nucleoporin autopeptidase, PF03093 nucleoporin FG repeat family Length = 1041 Score = 27.9 bits (59), Expect = 3.8 Identities = 28/105 (26%), Positives = 40/105 (38%), Gaps = 5/105 (4%) Frame = -3 Query: 300 GYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRS-EPYLPSI--GFHGTRTLRQKRK 130 G+G P++ PSP F +++ + P S+ P P+I GT T Sbjct: 410 GFGISPSQPNPFSPSPAFGQTSANPTNPFSSSTSTNPFAPQTPTIASSSFGTATSNFGSS 469 Query: 129 LFPDLSAASSGHFGLPRRTLVFKDEGTIIETVPLP--GSGIGTGF 1 F S+++ G T VF T P P GS GF Sbjct: 470 PFGVTSSSNLFGSGSSTTTSVFGSSSAFGTTTPSPLFGSSSTPGF 514 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 5.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 113 ERSGKSFLFCLSVRVPWNPIEG 178 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical to DNA Helicase [Arabidopsis thaliana] GI:11121449 Length = 1188 Score = 27.5 bits (58), Expect = 5.1 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 276 HLHVHPSPEFSRSAESIRTPPQMRCSSRSE 187 H H +P+ S S S+RTPP R +SR E Sbjct: 229 HYHSTSTPQPSVSNFSLRTPPVDRSASRLE 258 >At3g56510.1 68416.m06284 TBP-binding protein, putative similar to TBP-binding protein ABT1 GI:6518527 from [Mus musculus] Length = 257 Score = 27.1 bits (57), Expect = 6.7 Identities = 17/68 (25%), Positives = 28/68 (41%) Frame = -2 Query: 205 VLFAFRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSNTRF*RRGNDY*NGSAA 26 +L + + Y P +S AQ +K G G F WV + +R D NG Sbjct: 69 ILAQYGELGRIYLAPEDSEAQVHRKRAGGFRGQRFSEGWVEFAKKSVAKRVADMLNGEQI 128 Query: 25 GFRNRNRI 2 G + ++ + Sbjct: 129 GGKKKSSV 136 >At2g05210.1 68415.m00549 expressed protein Length = 364 Score = 27.1 bits (57), Expect = 6.7 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -3 Query: 234 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHFGLPR 79 +S T C+ +E Y +GF T TLR+KR L S +F PR Sbjct: 282 DSTATLEAFLCNKDAE-YFWGLGFQDTETLRKKRNWL--LGIRESSNFVAPR 330 >At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase family protein low similarity to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 530 Score = 27.1 bits (57), Expect = 6.7 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -1 Query: 161 MELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRERLL 42 MEL+RS ++ T +RRLQ L +P E S L + +L Sbjct: 60 MELDRS----DNVHTVKRRLQIALNFPTEESSLTYGDMVL 95 >At2g03890.1 68415.m00351 phosphatidylinositol 3- and 4-kinase family protein low similarity to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 650 Score = 27.1 bits (57), Expect = 6.7 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -1 Query: 161 MELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRERLL 42 MEL+RS ++ T +RRLQ L +P E S L + +L Sbjct: 60 MELDRS----DNVHTVKRRLQIALNFPTEESSLTYGDMVL 95 >At1g75510.1 68414.m08774 transcription initiation factor IIF beta subunit (TFIIF-beta) family protein contains Pfam profile: PF02270 transcription initiation factor IIF, beta subunit Length = 261 Score = 27.1 bits (57), Expect = 6.7 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +2 Query: 344 CR*GKSANWIRNFGIRIGSEDRGVSGLDGKRMRPVPGLV----NNIKKKKK 484 CR S ++N I++ DRGV MRP+PG++ +N K+K+K Sbjct: 131 CRERTSKAMVKNRQIQVIDNDRGV------HMRPMPGMLGLVSSNSKEKRK 175 >At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-PROT:P08927- RuBisCO subunit binding-protein beta subunit, chloroplast precursor (60 kDa chaperonin beta subunit, CPN-60 beta) [Pisum sativum]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 597 Score = 26.6 bits (56), Expect = 8.9 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -3 Query: 240 SAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHF 91 S S PP R SS + S F T+++ Q++ FP + AA HF Sbjct: 10 SMGSSLAPPSNRLSSFVS--ISSSSFGRTQSIAQRKARFPKIYAAKQLHF 57 >At3g02270.1 68416.m00208 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein similar to SP|Q13144 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Homo sapiens}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 676 Score = 26.6 bits (56), Expect = 8.9 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 195 RSEPYLPSIGFHGTRTLRQKRK 130 R+ PY+P + F G RTL+ +R+ Sbjct: 288 RTFPYVPDMKFSGNRTLKLERQ 309 >At2g45570.1 68415.m05667 cytochrome P450 76C2, putative (CYP76C2) (YLS6) identical to SP|O64637 Cytochrome P450 76C2 (EC 1.14.-.-) {Arabidopsis thaliana}, cDNA YLS6 mRNA for cytochrome P450 (CYP76C2), partial cds GI:13122289 Length = 512 Score = 26.6 bits (56), Expect = 8.9 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 483 FFFFFILFTRPGTGRIRFPSKPDTPR 406 FF F TRP + R PS P PR Sbjct: 19 FFIIFFTTTRPRSSRKVVPSPPGPPR 44 >At1g50410.1 68414.m05650 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 981 Score = 26.6 bits (56), Expect = 8.9 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -1 Query: 341 ILSTRGSSPWRPAADMGTNRRDISTYIPHLNFQGPQRVSGHRR 213 I TR P G++RRD+ST PH +GH + Sbjct: 15 IQETRTRPQHPPRIAEGSHRRDLSTLRPHFLSGSSSGANGHTK 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,693,321 Number of Sequences: 28952 Number of extensions: 262857 Number of successful extensions: 830 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 838967680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -