BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0456 (792 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0816 + 27928812-27930059,27931007-27931111,27931197-279312... 33 0.20 01_05_0539 + 23031976-23032216,23032896-23033341 28 7.4 >03_05_0816 + 27928812-27930059,27931007-27931111,27931197-27931262, 27931337-27931501,27931671-27931745,27931829-27931983, 27932234-27932369,27932454-27932523,27932602-27932729, 27932838-27932894,27933326-27933511,27934031-27934123, 27934488-27934573,27934668-27934734,27934873-27934939, 27935016-27935152,27935618-27935709,27935849-27935915, 27936058-27936078 Length = 1006 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 2/74 (2%) Frame = +3 Query: 561 SRYY*ITLHDRPCQLLNALVIDNVVPGVDRV-W*HRSTVGISR-IPGWRLVLPFLQKLFS 734 SR Y + H L NA+ DN V + ++ HR + S+ +P W LP L Sbjct: 905 SRLYNVIKHPNALDLDNAMAYDNAVSALGKICQFHRDGIDASQVVPAWLSCLPIKNDLIE 964 Query: 735 DLLLNDNQVSFLNK 776 ++++ + L K Sbjct: 965 AKIVHEQLCTMLEK 978 >01_05_0539 + 23031976-23032216,23032896-23033341 Length = 228 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -1 Query: 789 KSYFIYLKKKLDYR*AINPRRVFEEMATLSATRGSGKYRPLTDVTRPDR 643 + Y L KK+ Y N R + + T+ +R G YR D+TR +R Sbjct: 70 REYSPKLLKKIGYH-LYNCRELTIPLQTIEESRAGGAYRETHDMTRNER 117 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,524,149 Number of Sequences: 37544 Number of extensions: 217136 Number of successful extensions: 618 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2138915688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -