BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0455 (328 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 22 1.4 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 2.5 Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. 20 5.7 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 20 5.7 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 22.2 bits (45), Expect = 1.4 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 293 PLEHGPPRMGLPRPQLTFGETRYAPSTKLAAP 198 PL PR+G P+ +G + S + +AP Sbjct: 68 PLHPSVPRLGHPQWPFAWGSLXRSSSPQTSAP 99 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 21.4 bits (43), Expect = 2.5 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 184 LPTIGGAASFVLGA*RVSPKVSCGRGRPI--LGGPCSRGGPVPNSPY 318 +P GGA G+ P V +G P GGP S G P PY Sbjct: 36 VPQGGGAVQPDPGS--CDPSVGLRQGIPPHHYGGPPSGGQPPQGMPY 80 >Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. Length = 72 Score = 20.2 bits (40), Expect = 5.7 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = +3 Query: 147 GTSPWELEAESLAADYRWRSE 209 G S W++ D +WR E Sbjct: 1 GWSLWKVRGRCEGKDSKWRGE 21 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 20.2 bits (40), Expect = 5.7 Identities = 10/29 (34%), Positives = 11/29 (37%) Frame = +2 Query: 215 CSGRSASPRK*AAGAEGPFSAVRARGGAR 301 C G + R A A ARG AR Sbjct: 267 CGGEEEAERAPAPAVRAAGDAAAARGAAR 295 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,209 Number of Sequences: 336 Number of extensions: 1387 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6261139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -