BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0454 (487 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 7.3 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 22 9.7 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.6 bits (46), Expect = 7.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 71 CSLVLPKMHIEVQVALNFVISY 136 C L+LP + + V V +N+ + Y Sbjct: 4 CELLLPALLLLVSVQVNYSLQY 25 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 22.2 bits (45), Expect = 9.7 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -3 Query: 386 LHLDQPRQPDPWAGVLVHHVRALPTPSPLFQALDP 282 L L Q PDP+A +LV T +LDP Sbjct: 16 LFLSQTGLPDPFAKILVEGTTQEYTTEICKASLDP 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,335 Number of Sequences: 2352 Number of extensions: 12523 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42708759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -