BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0453 (710 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyce... 28 1.5 SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr ... 27 2.6 SPBC26H8.01 |thi2|nmt2|thiazole biosynthetic enzyme|Schizosaccha... 26 4.6 SPCC970.06 |||cargo receptor for soluble proteins |Schizosacchar... 25 8.1 >SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 27.9 bits (59), Expect = 1.5 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 476 YHHPAYFCREAVMRFGLKGGAAVVTILETLELVSQGG 586 + P+ F E V+ L GG AVV + TLE + Q G Sbjct: 87 FKKPSSFTGEDVVELQLHGGTAVVDV--TLEAIKQSG 121 >SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 27.1 bits (57), Expect = 2.6 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +2 Query: 254 SI*IHLFIEVGSGLVLPLALLKSMGDGNHSPSGGSYARL 370 SI I+LFI +G +++P ALL S NH S S++ L Sbjct: 558 SIGINLFILIGCYVIIPTALLGS----NHDLSKSSFSGL 592 >SPBC26H8.01 |thi2|nmt2|thiazole biosynthetic enzyme|Schizosaccharomyces pombe|chr 2|||Manual Length = 328 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 352 T*W*VVTVAHGLQQCQGQNQAAAYL 278 T W +V++ HGLQ C N A+L Sbjct: 201 TNWTLVSLNHGLQSCMDPNTINAHL 225 >SPCC970.06 |||cargo receptor for soluble proteins |Schizosaccharomyces pombe|chr 3|||Manual Length = 302 Score = 25.4 bits (53), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 247 CAVNMNSFIHRGRQRLGSAPGIAEVHGRR 333 C V ++FIHR R P ++E H +R Sbjct: 157 CLVASDTFIHRRINRFAGLPAVSE-HNKR 184 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,134,135 Number of Sequences: 5004 Number of extensions: 66749 Number of successful extensions: 122 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -