BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0452 (623 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 0.68 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 0.68 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 0.68 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 0.68 L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protei... 22 3.6 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.68 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = +2 Query: 266 DNVSKSQIINMTECILWHTDKIQHAYVNEFNNLSHLISTSGLWYV*SFIMLGLLKNIIYL 445 D + K + E I HTD V ++++ + + + +W+ M+ LK+I+ L Sbjct: 528 DEIQKEKGDEYYETISNHTDASSAKAVKNSDHITRIYACATMWHENKEEMMEFLKSILRL 587 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.68 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = +2 Query: 266 DNVSKSQIINMTECILWHTDKIQHAYVNEFNNLSHLISTSGLWYV*SFIMLGLLKNIIYL 445 D + K + E I HTD V ++++ + + + +W+ M+ LK+I+ L Sbjct: 528 DEIQKEKGDEYYETISNHTDASSAKAVKNSDHITRIYACATMWHENKEEMMEFLKSILRL 587 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.68 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = +2 Query: 266 DNVSKSQIINMTECILWHTDKIQHAYVNEFNNLSHLISTSGLWYV*SFIMLGLLKNIIYL 445 D + K + E I HTD V ++++ + + + +W+ M+ LK+I+ L Sbjct: 528 DEIQKEKGDEYYETISNHTDASSAKAVKNSDHITRIYACATMWHENKEEMMEFLKSILRL 587 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.68 Identities = 14/60 (23%), Positives = 28/60 (46%) Frame = +2 Query: 266 DNVSKSQIINMTECILWHTDKIQHAYVNEFNNLSHLISTSGLWYV*SFIMLGLLKNIIYL 445 D + K + E I HTD V ++++ + + + +W+ M+ LK+I+ L Sbjct: 528 DEIQKEKGDEYYETISNHTDASSAKAVKNSDHITRIYACATMWHENKEEMMEFLKSILRL 587 >L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protein protein. Length = 46 Score = 22.2 bits (45), Expect = 3.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 56 CTLCKDAFSFPTIL 97 CT+C AFS P +L Sbjct: 10 CTICPKAFSRPWLL 23 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,608 Number of Sequences: 336 Number of extensions: 3685 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -