BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0452 (623 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY324310-1|AAQ89695.1| 160|Anopheles gambiae insulin-like pepti... 23 7.9 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 7.9 >AY324310-1|AAQ89695.1| 160|Anopheles gambiae insulin-like peptide 4 precursor protein. Length = 160 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 353 THLRRHVVSYLCAKECILSYLLS 285 T RR V C ++C ++ LLS Sbjct: 126 TRFRRDVADECCREDCSMAQLLS 148 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = -1 Query: 320 CAKECILSYLLSVTSKHYLHKIKILFGIHKHYI*IITWRFS 198 CA+ C+L + + +YL+ I + ++ +RFS Sbjct: 110 CARRCLLEVIATQEYLYYLNIEHIFVALRDQHVFRAKFRFS 150 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 646,338 Number of Sequences: 2352 Number of extensions: 13723 Number of successful extensions: 45 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -