BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0450 (693 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 5.5 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 7.2 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 7.2 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 Query: 80 MDPVTRRRFLKH 45 +DPV +RR L+H Sbjct: 127 LDPVVKRRLLQH 138 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -2 Query: 665 GASAASGVLISGTAAASLSTLGAKSIFFTMLGMM 564 G SG + A L L A +FF + G+M Sbjct: 64 GTFLISGFQMQKIATKGLDLLEANRLFFFLTGVM 97 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -2 Query: 665 GASAASGVLISGTAAASLSTLGAKSIFFTMLGMM 564 G SG + A L L A +FF + G+M Sbjct: 64 GTFLISGFQMQKIATKGLDLLEANRLFFFLTGVM 97 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.316 0.130 0.359 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,820 Number of Sequences: 336 Number of extensions: 1880 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -