BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0449 (718 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 23 1.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.3 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 4.3 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 22 4.3 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -1 Query: 163 YLYISQYIHICKQS*LMLVKLSNVSNNRYHET 68 Y+ + ++IC + L+ K+SN++ + H T Sbjct: 171 YVQAIEVLYICSYTVLIRNKISNLNTSLIHST 202 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -3 Query: 251 KVFNMPLNNDYLGTHETESCVSVISGI 171 K++ MP +++L TE+C ++ S I Sbjct: 147 KLWKMPSLSEFLSLFGTETCPAIGSAI 173 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -3 Query: 251 KVFNMPLNNDYLGTHETESCVSVISGI 171 K++ MP +++L TE+C ++ S I Sbjct: 147 KLWKMPSLSEFLSLFGTETCPAIGSAI 173 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.2 bits (45), Expect = 4.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 600 FSILNSIEKLL*LYL*AKIFPMFVYKKVSFNYSKLCH 490 F+ILN + L YL K ++V ++SK+C+ Sbjct: 192 FAILNKQIRFLNQYLRLKPEGRISNRRVFISFSKICY 228 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 22.2 bits (45), Expect = 4.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 600 FSILNSIEKLL*LYL*AKIFPMFVYKKVSFNYSKLCH 490 F+ILN + L YL K ++V ++SK+C+ Sbjct: 210 FAILNKQIRFLNQYLRLKPEGRISNRRVFISFSKICY 246 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,574 Number of Sequences: 336 Number of extensions: 3266 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -