BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0449 (718 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47367| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 29 5.0 >SB_47367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 914 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +1 Query: 157 TDIFSIPDITETHDSVSWVPR*SLFRGILKTFKSCF*SGNRAVD 288 +++ ++PD+ ET ++S S++RG L + C RA+D Sbjct: 770 SELETVPDVVETSGALSVKSSSSIYRGCLNSTPKCILDAGRAMD 813 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -2 Query: 411 RH*WQPSQKAVTLSNSIILLIKVFNLFC 328 RH W+PS++A+TL+ + L + F + C Sbjct: 299 RHRWRPSRQALTLNKFLWLSVVAFTVPC 326 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,149,938 Number of Sequences: 59808 Number of extensions: 337068 Number of successful extensions: 438 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 438 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -