BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0449 (718 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT025849-1|ABF85749.1| 407|Drosophila melanogaster IP14878p pro... 29 8.4 AE014298-3188|AAN09569.1| 1751|Drosophila melanogaster CG14616-P... 29 8.4 >BT025849-1|ABF85749.1| 407|Drosophila melanogaster IP14878p protein. Length = 407 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -3 Query: 287 STARFPL*KHDLKVFNMPLNNDYLGTHETESCVSVISGIENI 162 S + FP + LK M DY T+SC+++ SG + Sbjct: 243 SNSNFPFESNTLKRVPMQTTKDYDNVSHTQSCINLKSGSSGV 284 >AE014298-3188|AAN09569.1| 1751|Drosophila melanogaster CG14616-PC, isoform C protein. Length = 1751 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -3 Query: 287 STARFPL*KHDLKVFNMPLNNDYLGTHETESCVSVISGIENI 162 S + FP + LK M DY T+SC+++ SG + Sbjct: 1587 SNSNFPFESNTLKRVPMQTTKDYDNVSHTQSCINLKSGSSGV 1628 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,252,539 Number of Sequences: 53049 Number of extensions: 486252 Number of successful extensions: 627 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 624 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3190721655 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -