BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0449 (718 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 2.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 6.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 6.7 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 Query: 396 PSQKAVTLSNSIILLIKVFNLFCPITL 316 P +KA N + +++FNL C + L Sbjct: 262 PVRKATLFLNMASVFMRIFNLICMMLL 288 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 6.7 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -3 Query: 245 FNMPLNNDYLGTHETESCVSVISGIENISV 156 FN + D L SC S++SGI SV Sbjct: 307 FNNNVYKDALIVCTVNSCTSMLSGIVIFSV 336 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 6.7 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -3 Query: 245 FNMPLNNDYLGTHETESCVSVISGIENISV 156 FN + D L SC S++SGI SV Sbjct: 360 FNNNVYKDALIVCTVNSCTSMLSGIVIFSV 389 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,715 Number of Sequences: 438 Number of extensions: 3654 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -