BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0444 (362 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 50 6e-07 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-06 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 9e-06 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 9e-06 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-05 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-05 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-05 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 44 4e-05 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 43 6e-05 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 43 6e-05 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 43 6e-05 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-05 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 43 9e-05 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 43 9e-05 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 42 1e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 42 1e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 42 1e-04 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 42 1e-04 SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 42 1e-04 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 42 1e-04 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 42 1e-04 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 42 1e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 42 1e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 42 1e-04 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 42 1e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 42 1e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 42 1e-04 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 42 1e-04 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 42 1e-04 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 42 1e-04 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 42 1e-04 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 1e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 42 2e-04 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 42 2e-04 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 42 2e-04 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 42 2e-04 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 42 2e-04 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 42 2e-04 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 41 3e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 41 3e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 41 3e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 41 3e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 41 3e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 41 3e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 41 3e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 41 3e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 41 3e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 41 3e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 41 3e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 41 3e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 41 3e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 41 3e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 41 3e-04 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 41 3e-04 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 41 3e-04 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 41 3e-04 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 41 3e-04 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 41 3e-04 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 41 3e-04 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 41 3e-04 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 41 3e-04 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 41 3e-04 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 41 3e-04 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 41 3e-04 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 41 3e-04 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 41 3e-04 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 41 3e-04 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 41 3e-04 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 41 3e-04 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 41 3e-04 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 3e-04 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 50.0 bits (114), Expect = 6e-07 Identities = 22/49 (44%), Positives = 30/49 (61%) Frame = -2 Query: 163 DGYKQKTKSGVHIVEQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 DGY K + ++ ++ +LR + + NSCSPGDPLV ERPPPR Sbjct: 769 DGYSVGAKVKIALMGLIYRKIFLRVMLVAISSNSCSPGDPLVLERPPPR 817 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 48.0 bits (109), Expect = 2e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -2 Query: 109 STTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 +T LR FR++ NSCSPGDPLV ERPPPR Sbjct: 6 TTWALRVQRFRIISNSCSPGDPLVLERPPPR 36 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 46.0 bits (104), Expect = 9e-06 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = -2 Query: 112 FSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 FST + +L NSCSPGDPLV ERPPPR Sbjct: 22 FSTLKTKNAPLKLSSNSCSPGDPLVLERPPPR 53 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 46.0 bits (104), Expect = 9e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 RLV NSCSPGDPLV ERPPPR Sbjct: 25 RLVSNSCSPGDPLVLERPPPR 45 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 45.6 bits (103), Expect = 1e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 82 FRLVPNSCSPGDPLVXERPPPR 17 FR+ NSCSPGDPLV ERPPPR Sbjct: 50 FRVASNSCSPGDPLVLERPPPR 71 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.6 bits (103), Expect = 1e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 82 FRLVPNSCSPGDPLVXERPPPR 17 FR+ NSCSPGDPLV ERPPPR Sbjct: 15 FRVTSNSCSPGDPLVLERPPPR 36 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.2 bits (102), Expect = 2e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 82 FRLVPNSCSPGDPLVXERPPPR 17 F L+ NSCSPGDPLV ERPPPR Sbjct: 22 FPLISNSCSPGDPLVLERPPPR 43 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 45.2 bits (102), Expect = 2e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R+V NSCSPGDPLV ERPPPR Sbjct: 84 RIVSNSCSPGDPLVLERPPPR 104 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 44.8 bits (101), Expect = 2e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R+V NSCSPGDPLV ERPPPR Sbjct: 3473 RVVSNSCSPGDPLVLERPPPR 3493 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.8 bits (101), Expect = 2e-05 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = -2 Query: 115 VFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 VF ++ V ++V NSCSPGDPLV ERPPPR Sbjct: 14 VFLREFVYTVIQKVVSNSCSPGDPLVLERPPPR 46 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 44.4 bits (100), Expect = 3e-05 Identities = 21/41 (51%), Positives = 24/41 (58%) Frame = -2 Query: 139 SGVHIVEQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 + +H+VE V R NSCSPGDPLV ERPPPR Sbjct: 11 ANIHLVELVALAVVPNIWCMRKTSNSCSPGDPLVLERPPPR 51 >SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.4 bits (100), Expect = 3e-05 Identities = 19/38 (50%), Positives = 23/38 (60%) Frame = -2 Query: 130 HIVEQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 H + + S +R + NSCSPGDPLV ERPPPR Sbjct: 3 HFTDTLISANIVRLYYYTFGSNSCSPGDPLVLERPPPR 40 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.4 bits (100), Expect = 3e-05 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -2 Query: 100 YLRGV*FRLVPNSCSPGDPLVXERPPPR 17 +LR + F NSCSPGDPLV ERPPPR Sbjct: 55 HLRSLYFPETSNSCSPGDPLVLERPPPR 82 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.0 bits (99), Expect = 4e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 LV NSCSPGDPLV ERPPPR Sbjct: 24 LVSNSCSPGDPLVLERPPPR 43 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 4e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 LV NSCSPGDPLV ERPPPR Sbjct: 3 LVSNSCSPGDPLVLERPPPR 22 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 44.0 bits (99), Expect = 4e-05 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = -2 Query: 127 IVEQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 IV + +T+Y + NSCSPGDPLV ERPPPR Sbjct: 4 IVANIQATSYFLRNSSNISSNSCSPGDPLVLERPPPR 40 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 4e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 LV NSCSPGDPLV ERPPPR Sbjct: 17 LVSNSCSPGDPLVLERPPPR 36 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 4e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 LV NSCSPGDPLV ERPPPR Sbjct: 9 LVSNSCSPGDPLVLERPPPR 28 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 4e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 LV NSCSPGDPLV ERPPPR Sbjct: 5 LVSNSCSPGDPLVLERPPPR 24 >SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.0 bits (99), Expect = 4e-05 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 82 FRLVPNSCSPGDPLVXERPPPR 17 +R+ NSCSPGDPLV ERPPPR Sbjct: 10 YRIQSNSCSPGDPLVLERPPPR 31 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 4e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 LV NSCSPGDPLV ERPPPR Sbjct: 2 LVSNSCSPGDPLVLERPPPR 21 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.0 bits (99), Expect = 4e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 LV NSCSPGDPLV ERPPPR Sbjct: 26 LVSNSCSPGDPLVLERPPPR 45 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.0 bits (99), Expect = 4e-05 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = -2 Query: 127 IVEQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 ++ QV S+ G F + NSCSPGDPLV ERPPPR Sbjct: 47 VITQVHSSRLRHGSNF--LSNSCSPGDPLVLERPPPR 81 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 43.6 bits (98), Expect = 5e-05 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = -2 Query: 118 QVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 QVFS + L R NSCSPGDPLV ERPPPR Sbjct: 70 QVFSQSPLS----RFTSNSCSPGDPLVLERPPPR 99 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 17 LISNSCSPGDPLVLERPPPR 36 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.6 bits (98), Expect = 5e-05 Identities = 20/38 (52%), Positives = 22/38 (57%) Frame = -2 Query: 130 HIVEQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 H + + S R R NSCSPGDPLV ERPPPR Sbjct: 3 HFTDTLISANITRVTNSRPRSNSCSPGDPLVLERPPPR 40 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 37 LISNSCSPGDPLVLERPPPR 56 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 43.6 bits (98), Expect = 5e-05 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R V NSCSPGDPLV ERPPPR Sbjct: 182 RRVSNSCSPGDPLVLERPPPR 202 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 5e-05 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 RL NSCSPGDPLV ERPPPR Sbjct: 2 RLSSNSCSPGDPLVLERPPPR 22 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 8 LISNSCSPGDPLVLERPPPR 27 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R+ NSCSPGDPLV ERPPPR Sbjct: 24 RITSNSCSPGDPLVLERPPPR 44 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 43.6 bits (98), Expect = 5e-05 Identities = 23/44 (52%), Positives = 29/44 (65%), Gaps = 3/44 (6%) Frame = -2 Query: 139 SGVHIV---EQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 SGV++ E +FS ++R + NSCSPGDPLV ERPPPR Sbjct: 36 SGVNVASLREDLFSLQHVRAL-----SNSCSPGDPLVLERPPPR 74 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.6 bits (98), Expect = 5e-05 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R V NSCSPGDPLV ERPPPR Sbjct: 2 RRVSNSCSPGDPLVLERPPPR 22 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 40 LISNSCSPGDPLVLERPPPR 59 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 70 LISNSCSPGDPLVLERPPPR 89 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 34 LISNSCSPGDPLVLERPPPR 53 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect = 5e-05 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 106 TTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 TT+L+ V V NSCSPGDPLV ERPPPR Sbjct: 8 TTWLKFV--SKVSNSCSPGDPLVLERPPPR 35 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 43.6 bits (98), Expect = 5e-05 Identities = 22/51 (43%), Positives = 28/51 (54%) Frame = -2 Query: 169 GADGYKQKTKSGVHIVEQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 GA G ++ + +V T ++ R NSCSPGDPLV ERPPPR Sbjct: 25 GAAGDASRSTDALSLVPSTSVTLFIENRLMR--SNSCSPGDPLVLERPPPR 73 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 21 LISNSCSPGDPLVLERPPPR 40 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 16 LISNSCSPGDPLVLERPPPR 35 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 31 LISNSCSPGDPLVLERPPPR 50 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 43.6 bits (98), Expect = 5e-05 Identities = 21/39 (53%), Positives = 25/39 (64%) Frame = -2 Query: 133 VHIVEQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 V ++ V +T+YL NSCSPGDPLV ERPPPR Sbjct: 16 VTVITFVHTTSYLT---IHSASNSCSPGDPLVLERPPPR 51 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.6 bits (98), Expect = 5e-05 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R + NSCSPGDPLV ERPPPR Sbjct: 8 RYISNSCSPGDPLVLERPPPR 28 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 43.2 bits (97), Expect = 6e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 +V NSCSPGDPLV ERPPPR Sbjct: 347 IVSNSCSPGDPLVLERPPPR 366 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.2 bits (97), Expect = 6e-05 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R+ NSCSPGDPLV ERPPPR Sbjct: 21 RVTSNSCSPGDPLVLERPPPR 41 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 43.2 bits (97), Expect = 6e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -2 Query: 106 TTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 TTYL + ++ NSCSPGDPLV ERPPPR Sbjct: 46 TTYLSPL-EPILSNSCSPGDPLVLERPPPR 74 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.2 bits (97), Expect = 6e-05 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 82 FRLVPNSCSPGDPLVXERPPPR 17 F+ NSCSPGDPLV ERPPPR Sbjct: 5 FQATSNSCSPGDPLVLERPPPR 26 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 43.2 bits (97), Expect = 6e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 +V NSCSPGDPLV ERPPPR Sbjct: 77 IVSNSCSPGDPLVLERPPPR 96 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 43.2 bits (97), Expect = 6e-05 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R + NSCSPGDPLV ERPPPR Sbjct: 76 RFLSNSCSPGDPLVLERPPPR 96 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 43.2 bits (97), Expect = 6e-05 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R V NSCSPGDPLV ERPPPR Sbjct: 62 RPVSNSCSPGDPLVLERPPPR 82 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.2 bits (97), Expect = 6e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 +V NSCSPGDPLV ERPPPR Sbjct: 11 MVSNSCSPGDPLVLERPPPR 30 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 6e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 +V NSCSPGDPLV ERPPPR Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 43.2 bits (97), Expect = 6e-05 Identities = 19/23 (82%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -2 Query: 82 FRLVP-NSCSPGDPLVXERPPPR 17 F VP NSCSPGDPLV ERPPPR Sbjct: 42 FETVPSNSCSPGDPLVLERPPPR 64 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 43.2 bits (97), Expect = 6e-05 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R + NSCSPGDPLV ERPPPR Sbjct: 30 RSISNSCSPGDPLVLERPPPR 50 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.2 bits (97), Expect = 6e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 +V NSCSPGDPLV ERPPPR Sbjct: 13 IVSNSCSPGDPLVLERPPPR 32 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 6e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 +V NSCSPGDPLV ERPPPR Sbjct: 6 IVSNSCSPGDPLVLERPPPR 25 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 43.2 bits (97), Expect = 6e-05 Identities = 25/56 (44%), Positives = 30/56 (53%), Gaps = 5/56 (8%) Frame = -2 Query: 169 GADGYKQKTKSGVHI-VEQV--FSTTYLRGV*F--RLVPNSCSPGDPLVXERPPPR 17 G DG+ T G+ + +E + F Y L NSCSPGDPLV ERPPPR Sbjct: 177 GVDGFTTPTPPGIQLSIEHIPRFLLRYYGSAQNGKHLRSNSCSPGDPLVLERPPPR 232 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 6e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 +V NSCSPGDPLV ERPPPR Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.2 bits (97), Expect = 6e-05 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -2 Query: 82 FRLVPNSCSPGDPLVXERPPPR 17 F L NSCSPGDPLV ERPPPR Sbjct: 20 FLLPSNSCSPGDPLVLERPPPR 41 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 62 LLSNSCSPGDPLVLERPPPR 81 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 42.7 bits (96), Expect = 9e-05 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 119 IISNSCSPGDPLVLERPPPR 138 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 42.7 bits (96), Expect = 9e-05 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -2 Query: 100 YLRGV*FRLVPNSCSPGDPLVXERPPPR 17 Y+R R V NSCSPGDPLV ERPPPR Sbjct: 32 YIREFVLR-VSNSCSPGDPLVLERPPPR 58 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 9e-05 Identities = 22/44 (50%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -2 Query: 145 TKSGVHIVEQVFSTTYLRGV*FRL-VPNSCSPGDPLVXERPPPR 17 T +IV+ YL+G + NSCSPGDPLV ERPPPR Sbjct: 7 TLISANIVQLAADNAYLQGNGQKKNASNSCSPGDPLVLERPPPR 50 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 42.7 bits (96), Expect = 9e-05 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -2 Query: 100 YLRGV*FRLVPNSCSPGDPLVXERPPPR 17 Y R + NSCSPGDPLV ERPPPR Sbjct: 143 YSRNSRLEKISNSCSPGDPLVLERPPPR 170 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R NSCSPGDPLV ERPPPR Sbjct: 18 RFASNSCSPGDPLVLERPPPR 38 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 42.7 bits (96), Expect = 9e-05 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 14 IISNSCSPGDPLVLERPPPR 33 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.7 bits (96), Expect = 9e-05 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 13 IISNSCSPGDPLVLERPPPR 32 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 +V NSCSPGDPLV ERPPPR Sbjct: 7 VVSNSCSPGDPLVLERPPPR 26 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 54 LLSNSCSPGDPLVLERPPPR 73 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 2 LLSNSCSPGDPLVLERPPPR 21 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 42.7 bits (96), Expect = 9e-05 Identities = 23/46 (50%), Positives = 27/46 (58%), Gaps = 6/46 (13%) Frame = -2 Query: 136 GVHIVEQVFSTTYLRGV*F------RLVPNSCSPGDPLVXERPPPR 17 G + E +FS G+ F +L NSCSPGDPLV ERPPPR Sbjct: 40 GRNYPEGIFSVFGFSGIIFMEGRFPKLSSNSCSPGDPLVLERPPPR 85 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 82 FRLVPNSCSPGDPLVXERPPPR 17 F+ NSCSPGDPLV ERPPPR Sbjct: 44 FKPTSNSCSPGDPLVLERPPPR 65 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 6 LLSNSCSPGDPLVLERPPPR 25 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 42.7 bits (96), Expect = 9e-05 Identities = 20/47 (42%), Positives = 26/47 (55%) Frame = -2 Query: 157 YKQKTKSGVHIVEQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 YK +H Q +++ + + NSCSPGDPLV ERPPPR Sbjct: 8 YKPCLIPSLH-TSQALHHPFIQAKPYNIPSNSCSPGDPLVLERPPPR 53 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 +V NSCSPGDPLV ERPPPR Sbjct: 19 VVSNSCSPGDPLVLERPPPR 38 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.7 bits (96), Expect = 9e-05 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 5 IISNSCSPGDPLVLERPPPR 24 >SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R NSCSPGDPLV ERPPPR Sbjct: 8 RFASNSCSPGDPLVLERPPPR 28 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 42.7 bits (96), Expect = 9e-05 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 1 MISNSCSPGDPLVLERPPPR 20 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 1 LLSNSCSPGDPLVLERPPPR 20 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.7 bits (96), Expect = 9e-05 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 4 IISNSCSPGDPLVLERPPPR 23 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 42.7 bits (96), Expect = 9e-05 Identities = 19/21 (90%), Positives = 19/21 (90%), Gaps = 1/21 (4%) Frame = -2 Query: 76 LVP-NSCSPGDPLVXERPPPR 17 LVP NSCSPGDPLV ERPPPR Sbjct: 27 LVPSNSCSPGDPLVLERPPPR 47 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L+ NSCSPGDPLV ERPPPR Sbjct: 7 LLSNSCSPGDPLVLERPPPR 26 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 +L NSCSPGDPLV ERPPPR Sbjct: 660 QLASNSCSPGDPLVLERPPPR 680 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 42.7 bits (96), Expect = 9e-05 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 82 FRLVPNSCSPGDPLVXERPPPR 17 F + NSCSPGDPLV ERPPPR Sbjct: 33 FGFLSNSCSPGDPLVLERPPPR 54 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.7 bits (96), Expect = 9e-05 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 13 IISNSCSPGDPLVLERPPPR 32 >SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 42.7 bits (96), Expect = 9e-05 Identities = 20/34 (58%), Positives = 22/34 (64%) Frame = -2 Query: 118 QVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 +V T YL + NSCSPGDPLV ERPPPR Sbjct: 35 EVTHTHYLGEMEVTHTSNSCSPGDPLVLERPPPR 68 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 42.7 bits (96), Expect = 9e-05 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 26 IISNSCSPGDPLVLERPPPR 45 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 42.7 bits (96), Expect = 9e-05 Identities = 19/40 (47%), Positives = 25/40 (62%) Frame = -2 Query: 136 GVHIVEQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 G H T++++ + + NSCSPGDPLV ERPPPR Sbjct: 9 GAHTWTSRAVTSHIQKKGAKEISNSCSPGDPLVLERPPPR 48 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R NSCSPGDPLV ERPPPR Sbjct: 15 RTTSNSCSPGDPLVLERPPPR 35 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 42.3 bits (95), Expect = 1e-04 Identities = 21/33 (63%), Positives = 24/33 (72%), Gaps = 4/33 (12%) Frame = -2 Query: 103 TYLRGV*FRL----VPNSCSPGDPLVXERPPPR 17 TY+RG+ L + NSCSPGDPLV ERPPPR Sbjct: 50 TYVRGLETILEVQPLSNSCSPGDPLVLERPPPR 82 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 2 VSNSCSPGDPLVLERPPPR 20 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 42.3 bits (95), Expect = 1e-04 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 +++ NSCSPGDPLV ERPPPR Sbjct: 11 KVLSNSCSPGDPLVLERPPPR 31 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 15 LTSNSCSPGDPLVLERPPPR 34 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R + NSCSPGDPLV ERPPPR Sbjct: 8 RGISNSCSPGDPLVLERPPPR 28 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 117 VSNSCSPGDPLVLERPPPR 135 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R+ NSCSPGDPLV ERPPPR Sbjct: 54 RVPSNSCSPGDPLVLERPPPR 74 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 1066 VSNSCSPGDPLVLERPPPR 1084 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 42.3 bits (95), Expect = 1e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 14 VISNSCSPGDPLVLERPPPR 33 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 78 LTSNSCSPGDPLVLERPPPR 97 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 214 VSNSCSPGDPLVLERPPPR 232 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.3 bits (95), Expect = 1e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 17 KITSNSCSPGDPLVLERPPPR 37 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 5 LASNSCSPGDPLVLERPPPR 24 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 5 VSNSCSPGDPLVLERPPPR 23 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 42.3 bits (95), Expect = 1e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 27 KIASNSCSPGDPLVLERPPPR 47 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 6 LASNSCSPGDPLVLERPPPR 25 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 19 VSNSCSPGDPLVLERPPPR 37 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 42.3 bits (95), Expect = 1e-04 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 82 FRLVPNSCSPGDPLVXERPPPR 17 + + NSCSPGDPLV ERPPPR Sbjct: 20 YEVTSNSCSPGDPLVLERPPPR 41 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 11 VSNSCSPGDPLVLERPPPR 29 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 25 VSNSCSPGDPLVLERPPPR 43 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 17 LASNSCSPGDPLVLERPPPR 36 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 59 VSNSCSPGDPLVLERPPPR 77 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 31 VSNSCSPGDPLVLERPPPR 49 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 41 VSNSCSPGDPLVLERPPPR 59 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R + NSCSPGDPLV ERPPPR Sbjct: 21 RSLSNSCSPGDPLVLERPPPR 41 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 14 VSNSCSPGDPLVLERPPPR 32 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 6 VSNSCSPGDPLVLERPPPR 24 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.3 bits (95), Expect = 1e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 5 VISNSCSPGDPLVLERPPPR 24 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 37 LTSNSCSPGDPLVLERPPPR 56 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.3 bits (95), Expect = 1e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 2 KITSNSCSPGDPLVLERPPPR 22 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 20 LASNSCSPGDPLVLERPPPR 39 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 11 LTSNSCSPGDPLVLERPPPR 30 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 14 VSNSCSPGDPLVLERPPPR 32 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 88 LTSNSCSPGDPLVLERPPPR 107 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 42.3 bits (95), Expect = 1e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 17 VISNSCSPGDPLVLERPPPR 36 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 8 VSNSCSPGDPLVLERPPPR 26 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R+ NSCSPGDPLV ERPPPR Sbjct: 17 RVSSNSCSPGDPLVLERPPPR 37 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 23 VSNSCSPGDPLVLERPPPR 41 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 3 LASNSCSPGDPLVLERPPPR 22 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 15 LTSNSCSPGDPLVLERPPPR 34 >SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 42.3 bits (95), Expect = 1e-04 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -2 Query: 106 TTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 TT +R R NSCSPGDPLV ERPPPR Sbjct: 53 TTRMRNRITRGGSNSCSPGDPLVLERPPPR 82 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 27 VSNSCSPGDPLVLERPPPR 45 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 7 LASNSCSPGDPLVLERPPPR 26 >SB_8733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -2 Query: 82 FRLVPNSCSPGDPLVXERPPPR 17 F + NSCSPGDPLV ERPPPR Sbjct: 2 FNVGSNSCSPGDPLVLERPPPR 23 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 193 VSNSCSPGDPLVLERPPPR 211 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 9 VSNSCSPGDPLVLERPPPR 27 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 17 VSNSCSPGDPLVLERPPPR 35 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 42.3 bits (95), Expect = 1e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 25 VISNSCSPGDPLVLERPPPR 44 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 11 LTSNSCSPGDPLVLERPPPR 30 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 42.3 bits (95), Expect = 1e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -2 Query: 100 YLRGV*FRLVPNSCSPGDPLVXERPPPR 17 +LR + R NSCSPGDPLV ERPPPR Sbjct: 62 HLRMIENRRGSNSCSPGDPLVLERPPPR 89 >SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R+ NSCSPGDPLV ERPPPR Sbjct: 14 RVESNSCSPGDPLVLERPPPR 34 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 96 LASNSCSPGDPLVLERPPPR 115 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 4 LASNSCSPGDPLVLERPPPR 23 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 1e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 V NSCSPGDPLV ERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 41.9 bits (94), Expect = 1e-04 Identities = 18/22 (81%), Positives = 20/22 (90%), Gaps = 1/22 (4%) Frame = -2 Query: 79 RLVP-NSCSPGDPLVXERPPPR 17 +L+P NSCSPGDPLV ERPPPR Sbjct: 23 QLLPSNSCSPGDPLVLERPPPR 44 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 101 ISNSCSPGDPLVLERPPPR 119 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 261 ISNSCSPGDPLVLERPPPR 279 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.9 bits (94), Expect = 1e-04 Identities = 21/40 (52%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = -2 Query: 130 HIVEQVFSTTYLRGV*FRL--VPNSCSPGDPLVXERPPPR 17 H + + S LR F + NSCSPGDPLV ERPPPR Sbjct: 3 HFTDTLISANILRFSIFWTDRLSNSCSPGDPLVLERPPPR 42 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 13 ILSNSCSPGDPLVLERPPPR 32 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 41.9 bits (94), Expect = 1e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R NSCSPGDPLV ERPPPR Sbjct: 51 RSASNSCSPGDPLVLERPPPR 71 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 59 ISNSCSPGDPLVLERPPPR 77 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 81 QMASNSCSPGDPLVLERPPPR 101 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 9 ISNSCSPGDPLVLERPPPR 27 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 3 ISNSCSPGDPLVLERPPPR 21 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 13 ISNSCSPGDPLVLERPPPR 31 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 52 ISNSCSPGDPLVLERPPPR 70 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 51 ISNSCSPGDPLVLERPPPR 69 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 41.9 bits (94), Expect = 1e-04 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -2 Query: 97 LRGV*FRLVPNSCSPGDPLVXERPPPR 17 + G+ + NSCSPGDPLV ERPPPR Sbjct: 152 MEGINCEVGSNSCSPGDPLVLERPPPR 178 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 47 ISNSCSPGDPLVLERPPPR 65 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 7 ISNSCSPGDPLVLERPPPR 25 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.9 bits (94), Expect = 1e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R + NSCSPGDPLV ERPPPR Sbjct: 21 RHLSNSCSPGDPLVLERPPPR 41 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 18 ISNSCSPGDPLVLERPPPR 36 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 974 ISNSCSPGDPLVLERPPPR 992 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 6 ISNSCSPGDPLVLERPPPR 24 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 65 MLSNSCSPGDPLVLERPPPR 84 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 +++ NSCSPGDPLV ERPPPR Sbjct: 12 QVLSNSCSPGDPLVLERPPPR 32 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 1 ISNSCSPGDPLVLERPPPR 19 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 41.9 bits (94), Expect = 1e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R+ NSCSPGDPLV ERPPPR Sbjct: 320 RVRSNSCSPGDPLVLERPPPR 340 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 116 ISNSCSPGDPLVLERPPPR 134 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 14 ISNSCSPGDPLVLERPPPR 32 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 8 ISNSCSPGDPLVLERPPPR 26 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.9 bits (94), Expect = 1e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 R NSCSPGDPLV ERPPPR Sbjct: 17 RRASNSCSPGDPLVLERPPPR 37 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 8 QITSNSCSPGDPLVLERPPPR 28 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 36 QMASNSCSPGDPLVLERPPPR 56 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 52 ISNSCSPGDPLVLERPPPR 70 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 90 ISNSCSPGDPLVLERPPPR 108 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 104 ILSNSCSPGDPLVLERPPPR 123 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 1e-04 Identities = 21/39 (53%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -2 Query: 130 HIVEQVFSTTY-LRGV*FRLVPNSCSPGDPLVXERPPPR 17 H + + S LRG+ NSCSPGDPLV ERPPPR Sbjct: 3 HFTDTLISANIRLRGI--CAASNSCSPGDPLVLERPPPR 39 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 7 ISNSCSPGDPLVLERPPPR 25 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 12 ILSNSCSPGDPLVLERPPPR 31 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 6 ISNSCSPGDPLVLERPPPR 24 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 68 ISNSCSPGDPLVLERPPPR 86 >SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) Length = 551 Score = 41.9 bits (94), Expect = 1e-04 Identities = 18/23 (78%), Positives = 20/23 (86%), Gaps = 1/23 (4%) Frame = -2 Query: 82 FRLVP-NSCSPGDPLVXERPPPR 17 +R+V NSCSPGDPLV ERPPPR Sbjct: 423 YRMVSSNSCSPGDPLVLERPPPR 445 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 46 ISNSCSPGDPLVLERPPPR 64 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 45 ISNSCSPGDPLVLERPPPR 63 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 591 ISNSCSPGDPLVLERPPPR 609 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 12 ISNSCSPGDPLVLERPPPR 30 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.9 bits (94), Expect = 1e-04 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -2 Query: 73 VPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 10 ISNSCSPGDPLVLERPPPR 28 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.5 bits (93), Expect = 2e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 13 IASNSCSPGDPLVLERPPPR 32 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.5 bits (93), Expect = 2e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 1 MASNSCSPGDPLVLERPPPR 20 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.5 bits (93), Expect = 2e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 79 RLVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 18 KIPSNSCSPGDPLVLERPPPR 38 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.5 bits (93), Expect = 2e-04 Identities = 18/23 (78%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -2 Query: 82 FRLVP-NSCSPGDPLVXERPPPR 17 FR + NSCSPGDPLV ERPPPR Sbjct: 8 FRTISSNSCSPGDPLVLERPPPR 30 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 41.5 bits (93), Expect = 2e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 92 VLSNSCSPGDPLVLERPPPR 111 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 41.5 bits (93), Expect = 2e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 37 IASNSCSPGDPLVLERPPPR 56 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.5 bits (93), Expect = 2e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 23 LSSNSCSPGDPLVLERPPPR 42 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.5 bits (93), Expect = 2e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 15 VLSNSCSPGDPLVLERPPPR 34 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.5 bits (93), Expect = 2e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 20 ITSNSCSPGDPLVLERPPPR 39 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.5 bits (93), Expect = 2e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 7 LPSNSCSPGDPLVLERPPPR 26 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 41.5 bits (93), Expect = 2e-04 Identities = 19/38 (50%), Positives = 21/38 (55%) Frame = -2 Query: 130 HIVEQVFSTTYLRGV*FRLVPNSCSPGDPLVXERPPPR 17 H + + S R NSCSPGDPLV ERPPPR Sbjct: 3 HFTDTLISANIRRPTIQARKSNSCSPGDPLVLERPPPR 40 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 41.5 bits (93), Expect = 2e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 L NSCSPGDPLV ERPPPR Sbjct: 4 LSSNSCSPGDPLVLERPPPR 23 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.5 bits (93), Expect = 2e-04 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 ++ NSCSPGDPLV ERPPPR Sbjct: 33 VLSNSCSPGDPLVLERPPPR 52 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.5 bits (93), Expect = 2e-04 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 82 FRLVPNSCSPGDPLVXERPPPR 17 F NSCSPGDPLV ERPPPR Sbjct: 9 FYSASNSCSPGDPLVLERPPPR 30 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.5 bits (93), Expect = 2e-04 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -2 Query: 76 LVPNSCSPGDPLVXERPPPR 17 + NSCSPGDPLV ERPPPR Sbjct: 3 ITSNSCSPGDPLVLERPPPR 22 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,032,038 Number of Sequences: 59808 Number of extensions: 222075 Number of successful extensions: 2072 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2069 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 570200590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -