BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0444 (362 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC107163-1|AAI07164.1| 551|Homo sapiens hypothetical protein FL... 30 2.5 BC107162-1|AAI07163.1| 551|Homo sapiens hypothetical protein FL... 30 2.5 AK023367-1|BAB14544.1| 436|Homo sapiens protein ( Homo sapiens ... 30 2.5 BC117170-1|AAI17171.1| 1714|Homo sapiens collagen, type XXIV, al... 28 7.8 BC113654-1|AAI13655.1| 1714|Homo sapiens collagen, type XXIV, al... 28 7.8 AY244357-1|AAP80185.1| 1714|Homo sapiens alpha 1 type XXIV colla... 28 7.8 AL445427-1|CAI19120.1| 1714|Homo sapiens collagen, type XXIV, al... 28 7.8 AL359971-1|CAI16233.1| 1714|Homo sapiens collagen, type XXIV, al... 28 7.8 AL356059-1|CAH71121.1| 1714|Homo sapiens collagen, type XXIV, al... 28 7.8 >BC107163-1|AAI07164.1| 551|Homo sapiens hypothetical protein FLJ13305 protein. Length = 551 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 107 AKNLFDNMYTGFCFLLISICA-LSFAKELDKKQREKDFVP-LKYPGPFQ 247 AK L +NM+T FC C F ++++ K++VP + P PFQ Sbjct: 86 AKELINNMWTDFCVEDYIRCKDTGFHAAEKRRKKRKEWVPTITVPEPFQ 134 >BC107162-1|AAI07163.1| 551|Homo sapiens hypothetical protein FLJ13305 protein. Length = 551 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 107 AKNLFDNMYTGFCFLLISICA-LSFAKELDKKQREKDFVP-LKYPGPFQ 247 AK L +NM+T FC C F ++++ K++VP + P PFQ Sbjct: 86 AKELINNMWTDFCVEDYIRCKDTGFHAAEKRRKKRKEWVPTITVPEPFQ 134 >AK023367-1|BAB14544.1| 436|Homo sapiens protein ( Homo sapiens cDNA FLJ13305 fis, clone OVARC1001399. ). Length = 436 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 107 AKNLFDNMYTGFCFLLISICA-LSFAKELDKKQREKDFVP-LKYPGPFQ 247 AK L +NM+T FC C F ++++ K++VP + P PFQ Sbjct: 86 AKELINNMWTDFCVEDYIRCKDTGFHAAEKRRKKRKEWVPTITVPEPFQ 134 >BC117170-1|AAI17171.1| 1714|Homo sapiens collagen, type XXIV, alpha 1 protein. Length = 1714 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +3 Query: 219 YRLSTPVLSRTWVIGTGVRTGGYPEKGRAKTFGPLTPHFSQGP 347 +R +T L R +IG RTG EKG GP P GP Sbjct: 1427 HRGNTGPLGREGIIGPTGRTGPRGEKGFRGETGPQGPRGQPGP 1469 >BC113654-1|AAI13655.1| 1714|Homo sapiens collagen, type XXIV, alpha 1 protein. Length = 1714 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +3 Query: 219 YRLSTPVLSRTWVIGTGVRTGGYPEKGRAKTFGPLTPHFSQGP 347 +R +T L R +IG RTG EKG GP P GP Sbjct: 1427 HRGNTGPLGREGIIGPTGRTGPRGEKGFRGETGPQGPRGQPGP 1469 >AY244357-1|AAP80185.1| 1714|Homo sapiens alpha 1 type XXIV collagen precursor protein. Length = 1714 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +3 Query: 219 YRLSTPVLSRTWVIGTGVRTGGYPEKGRAKTFGPLTPHFSQGP 347 +R +T L R +IG RTG EKG GP P GP Sbjct: 1427 HRGNTGPLGREGIIGPTGRTGPRGEKGFRGETGPQGPRGQPGP 1469 >AL445427-1|CAI19120.1| 1714|Homo sapiens collagen, type XXIV, alpha 1 protein. Length = 1714 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +3 Query: 219 YRLSTPVLSRTWVIGTGVRTGGYPEKGRAKTFGPLTPHFSQGP 347 +R +T L R +IG RTG EKG GP P GP Sbjct: 1427 HRGNTGPLGREGIIGPTGRTGPRGEKGFRGETGPQGPRGQPGP 1469 >AL359971-1|CAI16233.1| 1714|Homo sapiens collagen, type XXIV, alpha 1 protein. Length = 1714 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +3 Query: 219 YRLSTPVLSRTWVIGTGVRTGGYPEKGRAKTFGPLTPHFSQGP 347 +R +T L R +IG RTG EKG GP P GP Sbjct: 1427 HRGNTGPLGREGIIGPTGRTGPRGEKGFRGETGPQGPRGQPGP 1469 >AL356059-1|CAH71121.1| 1714|Homo sapiens collagen, type XXIV, alpha 1 protein. Length = 1714 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +3 Query: 219 YRLSTPVLSRTWVIGTGVRTGGYPEKGRAKTFGPLTPHFSQGP 347 +R +T L R +IG RTG EKG GP P GP Sbjct: 1427 HRGNTGPLGREGIIGPTGRTGPRGEKGFRGETGPQGPRGQPGP 1469 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,895,664 Number of Sequences: 237096 Number of extensions: 1101865 Number of successful extensions: 2340 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2340 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2248517154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -