BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0444 (362 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023587-1|AAY84987.1| 253|Drosophila melanogaster IP09396p pro... 28 4.2 AE013599-2935|AAF57530.2| 253|Drosophila melanogaster CG15125-P... 28 4.2 BT009963-1|AAQ22432.1| 1067|Drosophila melanogaster RE72345p pro... 27 9.7 AJ252173-1|CAB64388.1| 1067|Drosophila melanogaster BAB-II prote... 27 9.7 AE014296-178|AAF47442.2| 1067|Drosophila melanogaster CG9102-PA ... 27 9.7 >BT023587-1|AAY84987.1| 253|Drosophila melanogaster IP09396p protein. Length = 253 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 155 ISICALSFAKELDKKQREKDFVPLKYPGPFQD 250 I C L + ++Q+ K FVP +Y G F D Sbjct: 188 IKKCNLQVTERYSRQQKIKQFVPARYCGFFHD 219 >AE013599-2935|AAF57530.2| 253|Drosophila melanogaster CG15125-PA protein. Length = 253 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 155 ISICALSFAKELDKKQREKDFVPLKYPGPFQD 250 I C L + ++Q+ K FVP +Y G F D Sbjct: 188 IKKCNLQVTERYSRQQKIKQFVPARYCGFFHD 219 >BT009963-1|AAQ22432.1| 1067|Drosophila melanogaster RE72345p protein. Length = 1067 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 182 KELDKKQREKDFVPLKYPGPFQDVGNRYGSPD 277 K ++K R +DF +PGP QD+ + +PD Sbjct: 1002 KSVNKSPRFEDF----FPGPGQDMSELFANPD 1029 >AJ252173-1|CAB64388.1| 1067|Drosophila melanogaster BAB-II protein protein. Length = 1067 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 182 KELDKKQREKDFVPLKYPGPFQDVGNRYGSPD 277 K ++K R +DF +PGP QD+ + +PD Sbjct: 1002 KSVNKSPRFEDF----FPGPGQDMSELFANPD 1029 >AE014296-178|AAF47442.2| 1067|Drosophila melanogaster CG9102-PA protein. Length = 1067 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 182 KELDKKQREKDFVPLKYPGPFQDVGNRYGSPD 277 K ++K R +DF +PGP QD+ + +PD Sbjct: 1002 KSVNKSPRFEDF----FPGPGQDMSELFANPD 1029 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,778,281 Number of Sequences: 53049 Number of extensions: 316588 Number of successful extensions: 806 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 24,988,368 effective HSP length: 76 effective length of database: 20,956,644 effective search space used: 922092336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -