BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0443 (759 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39863| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_45862| Best HMM Match : GMP_synt_C (HMM E-Value=0) 28 7.2 >SB_39863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2978 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/67 (23%), Positives = 29/67 (43%), Gaps = 8/67 (11%) Frame = +3 Query: 510 TVSSNFNHIFLYL*SGHWF--------FFLIEIL*SSRPPKFDTFTEAY*DISNTRTYFE 665 T++ F + +L +G+WF F + ++ + P FD + + Y Sbjct: 2021 TITKTFKQLLKHLFTGNWFSCIQPLSSFTNLSVILAGSSPLFDAIELSSKPVKRAYQYLN 2080 Query: 666 RRDKNLN 686 RDKN+N Sbjct: 2081 GRDKNMN 2087 >SB_45862| Best HMM Match : GMP_synt_C (HMM E-Value=0) Length = 687 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 662 KVCSSIRDILISFGKRIKFR 603 KVC +I + +FGKRIKF+ Sbjct: 182 KVCHNINRVCYAFGKRIKFQ 201 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,810,102 Number of Sequences: 59808 Number of extensions: 420362 Number of successful extensions: 764 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 764 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -