BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0443 (759 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT016119-1|AAV37004.1| 1234|Drosophila melanogaster LD04582p pro... 29 9.1 AL133503-5|CAB72240.1| 1234|Drosophila melanogaster EG:BACH48C10... 29 9.1 AE014298-392|AAN09075.1| 1234|Drosophila melanogaster CG2841-PC,... 29 9.1 AE014298-391|AAN09074.1| 1234|Drosophila melanogaster CG2841-PB,... 29 9.1 AE014298-390|AAF45776.2| 1234|Drosophila melanogaster CG2841-PA,... 29 9.1 >BT016119-1|AAV37004.1| 1234|Drosophila melanogaster LD04582p protein. Length = 1234 Score = 28.7 bits (61), Expect = 9.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 349 FHIDRRNDITAKSPRNYNETGSINVGDSFSNNICR 453 F R + +TAK+P Y+ + S+N DS N R Sbjct: 177 FSSSRHSKVTAKTPSPYSSSNSLNSMDSTGMNYTR 211 >AL133503-5|CAB72240.1| 1234|Drosophila melanogaster EG:BACH48C10.5 protein. Length = 1234 Score = 28.7 bits (61), Expect = 9.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 349 FHIDRRNDITAKSPRNYNETGSINVGDSFSNNICR 453 F R + +TAK+P Y+ + S+N DS N R Sbjct: 177 FSSSRHSKVTAKTPSPYSSSNSLNSMDSTGMNYTR 211 >AE014298-392|AAN09075.1| 1234|Drosophila melanogaster CG2841-PC, isoform C protein. Length = 1234 Score = 28.7 bits (61), Expect = 9.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 349 FHIDRRNDITAKSPRNYNETGSINVGDSFSNNICR 453 F R + +TAK+P Y+ + S+N DS N R Sbjct: 177 FSSSRHSKVTAKTPSPYSSSNSLNSMDSTGMNYTR 211 >AE014298-391|AAN09074.1| 1234|Drosophila melanogaster CG2841-PB, isoform B protein. Length = 1234 Score = 28.7 bits (61), Expect = 9.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 349 FHIDRRNDITAKSPRNYNETGSINVGDSFSNNICR 453 F R + +TAK+P Y+ + S+N DS N R Sbjct: 177 FSSSRHSKVTAKTPSPYSSSNSLNSMDSTGMNYTR 211 >AE014298-390|AAF45776.2| 1234|Drosophila melanogaster CG2841-PA, isoform A protein. Length = 1234 Score = 28.7 bits (61), Expect = 9.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 349 FHIDRRNDITAKSPRNYNETGSINVGDSFSNNICR 453 F R + +TAK+P Y+ + S+N DS N R Sbjct: 177 FSSSRHSKVTAKTPSPYSSSNSLNSMDSTGMNYTR 211 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,987,605 Number of Sequences: 53049 Number of extensions: 605554 Number of successful extensions: 1095 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1095 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3478915869 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -