BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0442 (626 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26H5.05 |||IPT/TIG ankyrin repeat protein|Schizosaccharomyce... 30 0.31 SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|c... 25 6.8 SPAC23C4.14 |alg1||mannosyltransferase complex subunit Alg1 |Sch... 25 9.0 >SPAC26H5.05 |||IPT/TIG ankyrin repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1151 Score = 29.9 bits (64), Expect = 0.31 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 205 EFKDIWTSL*TPVNDRIN*LLPYAED 128 +F+ T L TP N+ IN L PYAED Sbjct: 187 QFRQPITMLETPFNESINTLTPYAED 212 >SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 436 Score = 25.4 bits (53), Expect = 6.8 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 417 RRKIFTVSMLASFIYLLRMMDV 352 R KIF +S+L +YLL +D+ Sbjct: 266 RSKIFVISLLGYGVYLLAFLDL 287 >SPAC23C4.14 |alg1||mannosyltransferase complex subunit Alg1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 424 Score = 25.0 bits (52), Expect = 9.0 Identities = 8/38 (21%), Positives = 18/38 (47%) Frame = +1 Query: 358 HHSKKVDK*REHGNSKYFPTSESKRFVEPRRRYLFMYM 471 H V H N +++P +++P+ R F+++ Sbjct: 62 HPGSSVGLFESHENIRFYPIPSLPAYLQPKNRLQFLFL 99 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,672,773 Number of Sequences: 5004 Number of extensions: 54743 Number of successful extensions: 134 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -