BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0442 (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42974| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_531| Best HMM Match : wnt (HMM E-Value=0) 58 6e-09 SB_1139| Best HMM Match : wnt (HMM E-Value=0) 56 2e-08 SB_42523| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_22258| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8923| Best HMM Match : wnt (HMM E-Value=2.5e-22) 55 4e-08 SB_38182| Best HMM Match : wnt (HMM E-Value=0) 55 5e-08 SB_32204| Best HMM Match : wnt (HMM E-Value=8.2e-31) 55 5e-08 SB_31733| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_15165| Best HMM Match : wnt (HMM E-Value=6e-28) 55 5e-08 SB_14585| Best HMM Match : wnt (HMM E-Value=9.3e-17) 55 5e-08 SB_4360| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 5e-08 SB_25278| Best HMM Match : wnt (HMM E-Value=8.9e-18) 54 1e-07 SB_5369| Best HMM Match : wnt (HMM E-Value=2.9e-18) 53 2e-07 SB_5367| Best HMM Match : wnt (HMM E-Value=0) 51 9e-07 SB_40347| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_10627| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_46626| Best HMM Match : wnt (HMM E-Value=0) 39 0.003 SB_6659| Best HMM Match : HC2 (HMM E-Value=0.78) 30 1.8 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 28 5.4 SB_45509| Best HMM Match : PX (HMM E-Value=0.063) 28 7.1 SB_31415| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 >SB_42974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 60.5 bits (140), Expect = 1e-09 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 V+ M ECKCHG+S +CTVKTCW RLP FR VGD Sbjct: 199 VRNNMIVECKCHGLSEACTVKTCWKRLPDFRLVGD 233 >SB_531| Best HMM Match : wnt (HMM E-Value=0) Length = 646 Score = 58.0 bits (134), Expect = 6e-09 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 V+ M +CKCHG+SGSC +KTCW LP+FR VGD Sbjct: 498 VKKFMDLQCKCHGVSGSCNIKTCWRALPNFRIVGD 532 >SB_1139| Best HMM Match : wnt (HMM E-Value=0) Length = 500 Score = 56.4 bits (130), Expect = 2e-08 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVG 8 V+T M +CKCHG+SGSC+V+TCW + SFR VG Sbjct: 333 VKTNMSLDCKCHGVSGSCSVRTCWKSISSFRIVG 366 >SB_42523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 56.4 bits (130), Expect = 2e-08 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = -2 Query: 121 LLQHVQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVG 8 + Q V+ +K+EC+CHG+SGSC+ +TCW +L SF VG Sbjct: 95 VFQAVRATLKRECRCHGISGSCSTRTCWRKLSSFAEVG 132 >SB_22258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 55.2 bits (127), Expect = 4e-08 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 V+ +KQ+CKCHG+SG C+ K+CW LP F +GD Sbjct: 88 VKKTLKQQCKCHGLSGGCSSKSCWKTLPLFSEIGD 122 >SB_8923| Best HMM Match : wnt (HMM E-Value=2.5e-22) Length = 153 Score = 55.2 bits (127), Expect = 4e-08 Identities = 19/35 (54%), Positives = 28/35 (80%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 V+ M+++C+CHG+S +C +KTCW LP+FRSV D Sbjct: 2 VKNHMEKKCRCHGLSQTCQMKTCWWELPAFRSVSD 36 >SB_38182| Best HMM Match : wnt (HMM E-Value=0) Length = 289 Score = 54.8 bits (126), Expect = 5e-08 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 V+ +KQ+CKCHG+SG C+ K+CW LP F +GD Sbjct: 132 VKKTLKQQCKCHGVSGGCSSKSCWKTLPLFSEIGD 166 >SB_32204| Best HMM Match : wnt (HMM E-Value=8.2e-31) Length = 731 Score = 54.8 bits (126), Expect = 5e-08 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 V+ +KQ+CKCHG+SG C+ K+CW LP F +GD Sbjct: 574 VKKTLKQQCKCHGVSGGCSSKSCWKTLPLFSEIGD 608 >SB_31733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 726 Score = 54.8 bits (126), Expect = 5e-08 Identities = 18/29 (62%), Positives = 26/29 (89%) Frame = -2 Query: 91 QECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 ++CKCHG+SGSC++KTCWM+ +FR +GD Sbjct: 483 RKCKCHGLSGSCSMKTCWMQQANFRQIGD 511 >SB_15165| Best HMM Match : wnt (HMM E-Value=6e-28) Length = 224 Score = 54.8 bits (126), Expect = 5e-08 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 V+ +KQ+CKCHG+SG C+ K+CW LP F +GD Sbjct: 67 VKKTLKQQCKCHGVSGGCSSKSCWKTLPLFSEIGD 101 >SB_14585| Best HMM Match : wnt (HMM E-Value=9.3e-17) Length = 157 Score = 54.8 bits (126), Expect = 5e-08 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 V+ +KQ+CKCHG+SG C+ K+CW LP F +GD Sbjct: 51 VKKTLKQQCKCHGVSGGCSSKSCWKTLPLFSEIGD 85 >SB_4360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 54.8 bits (126), Expect = 5e-08 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = -2 Query: 94 KQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 K +CKCHGM GSC+VKTCW +P R +GD Sbjct: 18 KTKCKCHGMCGSCSVKTCWKTVPDIREIGD 47 Score = 34.7 bits (76), Expect = 0.062 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -2 Query: 61 SCTVKTCWMRLPSFRSVGD 5 +C +KTCW LP+FRSV D Sbjct: 136 TCQMKTCWWELPAFRSVSD 154 >SB_25278| Best HMM Match : wnt (HMM E-Value=8.9e-18) Length = 167 Score = 53.6 bits (123), Expect = 1e-07 Identities = 19/35 (54%), Positives = 24/35 (68%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 ++ + CKCHG SGSC KTCW +PSFR VG+ Sbjct: 2 IRNNLDLSCKCHGPSGSCNTKTCWKSVPSFRMVGE 36 >SB_5369| Best HMM Match : wnt (HMM E-Value=2.9e-18) Length = 354 Score = 52.8 bits (121), Expect = 2e-07 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVG 8 V+ MK EC+CHG S SC +TCW LP+FR +G Sbjct: 132 VKESMKLECRCHGPSSSCATETCWNALPAFREIG 165 >SB_5367| Best HMM Match : wnt (HMM E-Value=0) Length = 367 Score = 50.8 bits (116), Expect = 9e-07 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = -2 Query: 88 ECKCHGMSGSCTVKTCWMRLPSFRSVGDS 2 ECKCHG+ GSC +KTCW +L FR +G++ Sbjct: 213 ECKCHGVCGSCNLKTCWRQLVEFREIGNA 241 >SB_40347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 398 Score = 48.4 bits (110), Expect = 5e-06 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = -2 Query: 121 LLQHVQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGDS 2 +L V M+ +C+CHG+S SC VKTC LP F VG++ Sbjct: 243 MLDAVLALMRVQCRCHGVSSSCAVKTCSKSLPKFEEVGEA 282 >SB_10627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 448 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 V + ++ C+CHG+SG CT KTC RL FR V D Sbjct: 202 VHSRLEFHCRCHGVSGGCTAKTCIRRLGDFRLVAD 236 >SB_46626| Best HMM Match : wnt (HMM E-Value=0) Length = 359 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = -2 Query: 109 VQTEMKQECKCHGMSGSCTVKTCWMRLPSFRSVGD 5 V + EC CHG S SC +TC LPS R+V + Sbjct: 232 VNRSLLTECTCHGPSASCVTRTCSQALPSPRAVSN 266 >SB_6659| Best HMM Match : HC2 (HMM E-Value=0.78) Length = 245 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 274 SSKLLQIVKRWAGRHRTWTDHKSCHRDIHHSKKVDK 381 + K+L KRW R+W+ H+ C + +KK+ K Sbjct: 2 AKKILDQPKRWP--KRSWSTHRRCQNVLEETKKIAK 35 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 28.3 bits (60), Expect = 5.4 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -1 Query: 389 SRHLSTFLE*WMSLWHDL*SVHVR*RPAHLFTICNNLLDREMRSTG 252 SRHL T++ M+ W + VH R LLD+ +RS G Sbjct: 446 SRHLETYIGSHMAGWEIMEKVHTEFREQVAALAVEKLLDQFVRSKG 491 >SB_45509| Best HMM Match : PX (HMM E-Value=0.063) Length = 556 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +3 Query: 21 KLGSLIQQVFTVHEPDMPWHLHSCFISVCTC 113 K+G I Q++++H P+M H H+ + +CTC Sbjct: 73 KIGPCICQIWSIHIPNMV-HAHAKY-GLCTC 101 >SB_31415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -2 Query: 406 IYC----FHARVIYLPS*NDGCLCGMIYDRSTCGDD 311 +YC FH LPS +G LC +++R CGDD Sbjct: 75 LYCDGRVFHVGDGQLPS--EGYLCSGLFERLLCGDD 108 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,131,678 Number of Sequences: 59808 Number of extensions: 444990 Number of successful extensions: 1013 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 959 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1013 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -