BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0441 (755 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0713 - 27070063-27070126,27070202-27070290,27070369-270704... 29 3.0 02_02_0532 + 11227074-11227349,11227567-11227969,11228228-112285... 28 7.0 >03_05_0713 - 27070063-27070126,27070202-27070290,27070369-27070428, 27071110-27071215,27071309-27071428,27072340-27072476, 27072561-27072647,27073660-27073956 Length = 319 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 617 CPTLQTETNYCFTAEIGRAVMPTRADSQEVLPPGPTTI 730 CP + E++ T + AV P+ D++E++ P P I Sbjct: 255 CPKAKVESSVVATEQSNAAVSPSGIDNKELVVPNPENI 292 >02_02_0532 + 11227074-11227349,11227567-11227969,11228228-11228506, 11228736-11228838,11228932-11229013,11229260-11229370, 11229621-11229691,11229791-11229803 Length = 445 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 65 IRYCVTQSVKDTHIFTHLP 9 IR C TQ + H+F HLP Sbjct: 373 IRICQTQHTRSLHLFNHLP 391 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,522,602 Number of Sequences: 37544 Number of extensions: 428213 Number of successful extensions: 730 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 730 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -