BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0441 (755 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01110.1 68414.m00014 expressed protein contains Prosite PS00... 28 5.8 At4g39760.1 68417.m05631 kelch repeat-containing F-box family pr... 28 7.7 >At1g01110.1 68414.m00014 expressed protein contains Prosite PS00165: Serine/threonine dehydratases pyridoxal-phosphate attachment site Length = 364 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +2 Query: 593 RSQYSY-NGCPTLQTETNYCFTAEIGRAVMPTRADSQEVLP 712 R+ YSY + P+L++ NY FTA G ++ T ++ +LP Sbjct: 224 RAAYSYTSNTPSLRS--NYSFTARSGCSISTTMVNNASLLP 262 >At4g39760.1 68417.m05631 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 369 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 149 VQINGKLILAWDTLNISKGMKK 84 V ++GKL++ WD +SK KK Sbjct: 304 VNLDGKLVMIWDRFTLSKRNKK 325 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,609,355 Number of Sequences: 28952 Number of extensions: 350387 Number of successful extensions: 584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -