BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0440 (729 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 29 0.15 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 29 0.15 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 25 2.4 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 24 5.5 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 23 7.3 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 29.1 bits (62), Expect = 0.15 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +3 Query: 357 CVKIMYVMYSTKLASAWLKCQRTPNCTQSCWSHLLC 464 C V Y T L +A C TPN T + WSH C Sbjct: 164 CYYHFTVEYYTVLGAACQVC--TPNATNTVWSHCQC 197 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 29.1 bits (62), Expect = 0.15 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +3 Query: 357 CVKIMYVMYSTKLASAWLKCQRTPNCTQSCWSHLLC 464 C V Y T L +A C TPN T + WSH C Sbjct: 164 CYYHFTVEYYTVLGAACQVC--TPNATNTVWSHCQC 197 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 25.0 bits (52), Expect = 2.4 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = +2 Query: 491 TVTIRVRQTDKALVESLLGKAQTDYKNKIKKDVVLK----VDTENFLSPDTCGGIELVAA 658 T +R +T+K+L E+L G +QT+ K+ L+ D D G LVA+ Sbjct: 142 TTRLRAERTEKSLKEALEGCSQTETPVNGKRGRNLRSTEEADDAKRAKNDAPSGSSLVAS 201 Query: 659 RG 664 G Sbjct: 202 AG 203 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.8 bits (49), Expect = 5.5 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 202 RGGVQHRKGPSCPAATSQDYGIL*KEGEAG*TSEEDPIFEHAEPSS 339 RGG R P+ P ++ + I+ KE A ++ P F+ A P S Sbjct: 176 RGGAAIRTAPASPFPSAPNQQIIYKEQTANLQVQKVPAFQ-AMPES 220 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.4 bits (48), Expect = 7.3 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 341 DELGSACSKIGSS 303 D LGSACS++ SS Sbjct: 72 DSLGSACSQLSSS 84 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 696,589 Number of Sequences: 2352 Number of extensions: 13841 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -