BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0439 (709 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2G1H8 Cluster: Leucine Rich Repeat family protein; n=1... 34 3.9 >UniRef50_A2G1H8 Cluster: Leucine Rich Repeat family protein; n=1; Trichomonas vaginalis G3|Rep: Leucine Rich Repeat family protein - Trichomonas vaginalis G3 Length = 693 Score = 33.9 bits (74), Expect = 3.9 Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 10/111 (9%) Frame = -1 Query: 460 DCNSLRFKILQLGFNFILMYSLTNLNMLRCLETSNLFE*RHATIES-KAKNKLSMVPCRA 284 D NS+ I +L + L+ + N+N L+ LET N+ R +E+ + NKLS + Sbjct: 66 DLNSI-LNIKELDLSNNLISKIENINQLKSLETLNVSSNRIEVLENVEQLNKLSKIIAPE 124 Query: 283 SSVSTLNVFILENHSTYSGYVSIS-NP---FNSHLMF-----TVITECFLS 158 + + T VFI +N Y+ +S NP FN H +F ++ C+L+ Sbjct: 125 NRIHT--VFI-KNPLPALEYLDLSFNPISEFNYHQIFPNLKTLILNNCYLT 172 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 633,381,329 Number of Sequences: 1657284 Number of extensions: 12050056 Number of successful extensions: 23878 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 23249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23870 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56611575523 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -