BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0439 (709 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.07 |ubp10||ubiquitin C-terminal hydrolase Ubp10|Schizosa... 29 0.65 SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyc... 28 1.1 SPBC1706.03 |fzo1|SPBC839.01|mitochondrial fusion GTPase protein... 25 8.0 >SPBC577.07 |ubp10||ubiquitin C-terminal hydrolase Ubp10|Schizosaccharomyces pombe|chr 2|||Manual Length = 502 Score = 29.1 bits (62), Expect = 0.65 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 4/72 (5%) Frame = -1 Query: 454 NSLRFKILQLGFNFILMYSLTNLNMLRCLETSNLFE*R----HATIESKAKNKLSMVPCR 287 +++ K+L F + SLTNL++ CL F+ R HA + +N V C Sbjct: 62 DTINRKLLDFDFEKVCSVSLTNLSVYACLVCGRYFQGRGPSSHAYFHALTENHHVFVNC- 120 Query: 286 ASSVSTLNVFIL 251 STL ++L Sbjct: 121 ----STLKFYVL 128 >SPAC1782.01 ||SPAPYUG7.07|proteasome component|Schizosaccharomyces pombe|chr 1|||Manual Length = 1679 Score = 28.3 bits (60), Expect = 1.1 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +3 Query: 288 RHGTIDSLFLAFDSIVA*RYSNKFDVSRHLSMFKL--VKEYIRMKLNPSCKILNRKLLQS 461 R ++++L ++ Y N+ + ++S L +KE +R P CK+L R ++QS Sbjct: 1084 RESSVNTLVSLLSNVPVTEYLNQLEDIWNMSFRTLDDIKESVREASFPLCKLLARSVIQS 1143 >SPBC1706.03 |fzo1|SPBC839.01|mitochondrial fusion GTPase protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 758 Score = 25.4 bits (53), Expect = 8.0 Identities = 9/23 (39%), Positives = 18/23 (78%) Frame = -1 Query: 139 RLQL*RHYGLLLGVVEFLEITVT 71 RLQL +H+ LG+++F+++ +T Sbjct: 564 RLQLQKHFRFELGLLDFIDLDLT 586 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,754,837 Number of Sequences: 5004 Number of extensions: 55203 Number of successful extensions: 138 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -