BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0439 (709 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 25 0.53 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 25 0.53 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 3.7 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 3.7 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 8.7 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 25.4 bits (53), Expect = 0.53 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -1 Query: 301 MVPCRASSVSTLNVFILENHSTYSGYVSISNPFNSHLMFTVITE 170 ++PC S T+ F L + S +SIS + H+ F ++ E Sbjct: 252 IIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVE 295 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 25.4 bits (53), Expect = 0.53 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -1 Query: 301 MVPCRASSVSTLNVFILENHSTYSGYVSISNPFNSHLMFTVITE 170 ++PC S T+ F L + S +SIS + H+ F ++ E Sbjct: 252 IIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVE 295 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 701 LQLSAFCDYDND 666 L+L FCDYD D Sbjct: 40 LKLYLFCDYDRD 51 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -1 Query: 301 MVPCRASSVSTLNVFILENHSTYSGYVSISNPFNSHLMFTVITE 170 ++PC S T+ VF L + S +SIS + + F ++ E Sbjct: 248 IIPCMGISFLTVLVFYLPSDSGEKVSLSISILLSLTVFFLLLAE 291 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 238 TYSGYVSISNPFNSHLM 188 T Y++I +PF SH M Sbjct: 149 TVERYIAICHPFISHTM 165 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,352 Number of Sequences: 438 Number of extensions: 3867 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -