BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0435 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 23 2.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.1 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 394 IFCRLQNCMDSTVKKTDDRQLMPSVVNR 477 ++C+ +C+ V DD Q PSVV R Sbjct: 104 VYCKCDDCLLGIV---DDYQRNPSVVGR 128 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 8.1 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -3 Query: 551 NITIL*NDKTTNLFI*ILLPCFSSNLLTTDGINCRSS 441 N +L ND+ L++ + + F + L+ DGI S Sbjct: 1035 NQPLLVNDQLGQLYLDLEVEGFETKLVLEDGITSSGS 1071 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,520 Number of Sequences: 438 Number of extensions: 3576 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -