BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0434 (640 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14920.1 68415.m01697 sulfotransferase family protein similar... 32 0.37 At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) fa... 29 2.6 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 29 3.4 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 29 3.4 At1g76350.1 68414.m08871 RWP-RK domain-containing protein simila... 29 3.4 At3g12610.1 68416.m01570 DNA-damage-repair/toleration protein, p... 28 4.5 At2g07678.1 68415.m00915 hypothetical protein 28 4.5 At5g40950.1 68418.m04975 50S ribosomal protein L27, chloroplast,... 27 7.9 At2g34480.1 68415.m04233 60S ribosomal protein L18A (RPL18aB) 27 7.9 >At2g14920.1 68415.m01697 sulfotransferase family protein similar to steroid sulfotransferase from [Brassica napus] GI:3420008, GI:3420004; contains Pfam profile PF00685: Sulfotransferase domain Length = 333 Score = 31.9 bits (69), Expect = 0.37 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 520 QPAKNRVKQYPNDLTHHNPHAEAPKPKPELKLEIRNPD 633 Q +K+ ++ + + L HHNPH P + +L L+ PD Sbjct: 91 QRSKHSLEDHQHPLLHHNPHEIVPNLELDLYLKSSKPD 128 >At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 4706 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/64 (20%), Positives = 31/64 (48%) Frame = +1 Query: 97 ENVHGALEKREMSGFVCVLMLAGVASAQITLDGIRCGQLICQLDEYCSPETNRCAPCNVV 276 E ++++ E + + + ++T+ + CG ++C+ +CS +RC C + Sbjct: 4642 ERAEASMKEAETAKSQWLCQICQTKEVEVTI--VPCGHVLCR---HCSTSVSRCPFCRLQ 4696 Query: 277 CNKT 288 N+T Sbjct: 4697 VNRT 4700 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 523 PAKNRVKQYPNDLTHHNPHAEAPKPKPELKLEIRNPDP 636 P N V QYP HH P P P + L+ P P Sbjct: 59 PNPNPVYQYPASYYHHPPPGAMPLPPYDHHLQHHPPHP 96 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 523 PAKNRVKQYPNDLTHHNPHAEAPKPKPELKLEIRNPDP 636 P N V QYP HH P P P + L+ P P Sbjct: 59 PNPNPVYQYPASYYHHPPPGAMPLPPYDHHLQHHPPHP 96 >At1g76350.1 68414.m08871 RWP-RK domain-containing protein similar to nodule inception protein [Lotus japonicus] GI:6448579; contains Pfam profile: PF02042 RWP-RK domain Length = 808 Score = 28.7 bits (61), Expect = 3.4 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +2 Query: 167 SPPLKSPWTASDAVS*YVS*TNTAPRRPTDALRAMLSAIKHTITT 301 SPP KSP ++ S S T PTD R + + K T TT Sbjct: 655 SPPAKSPGSSCSHSSSCSSETQVIKEDPTDKTRLVSRSFKETQTT 699 >At3g12610.1 68416.m01570 DNA-damage-repair/toleration protein, putative (DRT100) similar to DNA-damage-repair/toleration protein DRT100 [Precursor] SWISS-PROT:Q00874, NCBI_gi:5701788; contains multiple LRR repeats Pfam profile: PF00560 Length = 372 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 142 RIPTSLSSLKHRVHFRRNRHKHCGMILSKFEF 47 RIP SLSS K H + +K CG I + F F Sbjct: 318 RIPDSLSSAKFVGHLDISHNKLCGRIPTGFPF 349 >At2g07678.1 68415.m00915 hypothetical protein Length = 245 Score = 28.3 bits (60), Expect = 4.5 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 66 YFLNLNFNFKAPRGLTGNN 10 Y NLN +F +P G TGNN Sbjct: 51 YIKNLNLDFTSPYGSTGNN 69 >At5g40950.1 68418.m04975 50S ribosomal protein L27, chloroplast, putative (RPL27) identical to SP|Q9FLN4 ribosomal protein L27, chloroplast precursor {Arabidopsis thaliana}; similar to SP|P30155 50S ribosomal protein L27, chloroplast precursor (CL27) {Nicotiana tabacum} Length = 198 Score = 27.5 bits (58), Expect = 7.9 Identities = 8/36 (22%), Positives = 20/36 (55%) Frame = +1 Query: 511 QKFQPAKNRVKQYPNDLTHHNPHAEAPKPKPELKLE 618 +KF P + ++ YP ++ NP++ + + +L+ Sbjct: 127 EKFGPDRKKISVYPREIVPENPNSYRARKRENFRLQ 162 >At2g34480.1 68415.m04233 60S ribosomal protein L18A (RPL18aB) Length = 178 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +2 Query: 56 FRKYHTTVLVSVPAKMYTVL*RRERCRDSCVS*CSLASPPLK 181 +++Y T L +MYT + R R R C+ A+ P K Sbjct: 93 YKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAK 134 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,240,422 Number of Sequences: 28952 Number of extensions: 291557 Number of successful extensions: 794 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -