BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0432 (696 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ295148-1|CAC14666.1| 439|Homo sapiens putative sialoglycoprot... 31 3.9 BC150266-1|AAI50267.1| 1336|Homo sapiens mitogen-activated prote... 30 9.1 AL031718-1|CAB72318.1| 552|Homo sapiens c371H6.1 (KIAA0516 prot... 30 9.1 AL031717-1|CAM26394.1| 1336|Homo sapiens mitogen-activated prote... 30 9.1 AL031710-1|CAM26364.1| 1336|Homo sapiens mitogen-activated prote... 30 9.1 AE006639-4|AAK61290.1| 1342|Homo sapiens similar to sperm specif... 30 9.1 AB028989-1|BAA83018.2| 1346|Homo sapiens KIAA1066 protein protein. 30 9.1 >AJ295148-1|CAC14666.1| 439|Homo sapiens putative sialoglycoprotease type 2 protein. Length = 439 Score = 31.1 bits (67), Expect = 3.9 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +2 Query: 461 QIIRKYVLRPEDIVSTTFIANIALDIGTSCEDTFAYFSDELG 586 + +R + PE T F+ I L I TSC+DT A DE G Sbjct: 21 EFLRSFNFHPE----TLFLHKIVLGIETSCDDTAAAVVDETG 58 >BC150266-1|AAI50267.1| 1336|Homo sapiens mitogen-activated protein kinase 8 interacting protein 3 protein. Length = 1336 Score = 29.9 bits (64), Expect = 9.1 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = +2 Query: 182 KLFVSVPRWRSGIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGN 316 K FVSVP + ATLN LD+P E P EG +L N Sbjct: 1240 KFFVSVP---GNVLATLNGSVLDSPAEGPGPAAPASEVEGQKLRN 1281 >AL031718-1|CAB72318.1| 552|Homo sapiens c371H6.1 (KIAA0516 protein) protein. Length = 552 Score = 29.9 bits (64), Expect = 9.1 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = +2 Query: 182 KLFVSVPRWRSGIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGN 316 K FVSVP + ATLN LD+P E P EG +L N Sbjct: 456 KFFVSVP---GNVLATLNGSVLDSPAEGPGPAAPASEVEGQKLRN 497 >AL031717-1|CAM26394.1| 1336|Homo sapiens mitogen-activated protein kinase 8 interacting protein 3 protein. Length = 1336 Score = 29.9 bits (64), Expect = 9.1 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = +2 Query: 182 KLFVSVPRWRSGIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGN 316 K FVSVP + ATLN LD+P E P EG +L N Sbjct: 1240 KFFVSVP---GNVLATLNGSVLDSPAEGPGPAAPASEVEGQKLRN 1281 >AL031710-1|CAM26364.1| 1336|Homo sapiens mitogen-activated protein kinase 8 interacting protein 3 protein. Length = 1336 Score = 29.9 bits (64), Expect = 9.1 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = +2 Query: 182 KLFVSVPRWRSGIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGN 316 K FVSVP + ATLN LD+P E P EG +L N Sbjct: 1240 KFFVSVP---GNVLATLNGSVLDSPAEGPGPAAPASEVEGQKLRN 1281 >AE006639-4|AAK61290.1| 1342|Homo sapiens similar to sperm specifc protein protein. Length = 1342 Score = 29.9 bits (64), Expect = 9.1 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = +2 Query: 182 KLFVSVPRWRSGIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGN 316 K FVSVP + ATLN LD+P E P EG +L N Sbjct: 1246 KFFVSVP---GNVLATLNGSVLDSPAEGPGPAAPASEVEGQKLRN 1287 >AB028989-1|BAA83018.2| 1346|Homo sapiens KIAA1066 protein protein. Length = 1346 Score = 29.9 bits (64), Expect = 9.1 Identities = 19/45 (42%), Positives = 22/45 (48%) Frame = +2 Query: 182 KLFVSVPRWRSGIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGN 316 K FVSVP + ATLN LD+P E P EG +L N Sbjct: 1250 KFFVSVP---GNVLATLNGSVLDSPAEGPGPAAPASEVEGQKLRN 1291 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,755,197 Number of Sequences: 237096 Number of extensions: 2486911 Number of successful extensions: 5044 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5044 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -