BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0424 (641 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1749 - 39636951-39638102 29 4.1 03_01_0423 + 3240224-3240394,3241464-3241628,3242322-3242339,324... 28 7.2 >01_06_1749 - 39636951-39638102 Length = 383 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 434 SSIVTTAAPPFKPKRITA 381 SS+ + AAPPF P RIT+ Sbjct: 164 SSVASAAAPPFDPSRITS 181 >03_01_0423 + 3240224-3240394,3241464-3241628,3242322-3242339, 3242494-3242836,3244138-3248540,3248928-3249107, 3249108-3250892,3251055-3252173 Length = 2727 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/58 (25%), Positives = 30/58 (51%) Frame = +3 Query: 81 SKVKATWAAEYCIAKFRFREIDYEDNSRLNFVCNVNLCSVTFKKLSHTFRVQGTVTSR 254 SK K+T ++EY + + +EID +++F CNV + + + ++G + R Sbjct: 2584 SKGKSTVSSEYSSIRAQLQEIDGSVLEQIDFNCNVTKKAENYPAFEVSAELEGYSSRR 2641 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,544,502 Number of Sequences: 37544 Number of extensions: 337669 Number of successful extensions: 629 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -