BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0424 (641 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 3.6 AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal... 23 8.2 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.2 bits (50), Expect = 3.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -3 Query: 402 QTETHYCFTAEIGRVVVPARAESQEVLPPVI 310 Q ET C+T+ A +E QEV P + Sbjct: 1179 QNETLSCYTSRRNSTTSNANSEPQEVAPQFV 1209 >AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 131 Score = 23.0 bits (47), Expect = 8.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 275 NKNETRKIIICVITGGRTSCDSAR 346 +KNE ++ +C+ T GR S + R Sbjct: 31 HKNEINEMRVCIGTNGRMSVPANR 54 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,419 Number of Sequences: 2352 Number of extensions: 12128 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -