BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0419 (393 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) 27 7.2 SB_11579| Best HMM Match : BRF1 (HMM E-Value=5.2) 27 7.2 >SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) Length = 1054 Score = 26.6 bits (56), Expect = 7.2 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -3 Query: 217 NECRKYILDMNIYTNN*SGHKYCHTVKTVLLEC 119 N+ KY+L ++ +N+ G + H+ + LL+C Sbjct: 725 NQLYKYLLKNSLISNHQFGFRRLHSTMSALLDC 757 >SB_11579| Best HMM Match : BRF1 (HMM E-Value=5.2) Length = 118 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 316 ELNQQ*SKKKKTRGGARYPIR 378 ELNQ+ KKKK G R P+R Sbjct: 8 ELNQREGKKKKEAKGKRAPVR 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,662,397 Number of Sequences: 59808 Number of extensions: 139480 Number of successful extensions: 279 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 278 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 678472135 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -