BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0418 (753 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51145| Best HMM Match : RCSD (HMM E-Value=1.3) 70 2e-12 SB_18740| Best HMM Match : MFS_1 (HMM E-Value=1.1e-15) 66 4e-11 SB_1462| Best HMM Match : MFS_1 (HMM E-Value=0.042) 66 4e-11 SB_1828| Best HMM Match : DUF938 (HMM E-Value=1.5) 66 4e-11 SB_25976| Best HMM Match : RVT_1 (HMM E-Value=5.3e-22) 63 3e-10 SB_11833| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_19693| Best HMM Match : Sugar_tr (HMM E-Value=0.0002) 62 4e-10 SB_37980| Best HMM Match : 7tm_2 (HMM E-Value=5.3e-13) 62 5e-10 SB_57462| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_14272| Best HMM Match : Sugar_tr (HMM E-Value=0.0046) 61 8e-10 SB_58422| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57282| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55675| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53531| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51851| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51844| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49026| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47126| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_42980| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_41200| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_39911| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_39828| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_38934| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_34283| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_29488| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28464| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23522| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_19655| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_18351| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_17016| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_15018| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13950| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12937| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_12563| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_9931| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5449| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59704| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 60 1e-09 SB_58431| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54126| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_45758| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_44961| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_44549| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_36128| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_35247| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_34984| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_34197| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_32036| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_28547| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26763| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26757| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_26470| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_24001| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23476| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23166| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_19253| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13603| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_13164| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11232| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_7675| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_4220| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1385| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_951| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57564| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_23705| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_51293| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_3186| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_7199| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_4525| Best HMM Match : Sugar_tr (HMM E-Value=0.028) 56 2e-08 SB_1829| Best HMM Match : 5TM-5TMR_LYT (HMM E-Value=3.3) 54 1e-07 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 54 2e-07 SB_12485| Best HMM Match : ATP-synt_C (HMM E-Value=3.9) 53 3e-07 SB_51144| Best HMM Match : Sugar_tr (HMM E-Value=0.13) 49 5e-06 SB_29014| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_53613| Best HMM Match : Sugar_tr (HMM E-Value=0.00012) 43 2e-04 SB_896| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56587| Best HMM Match : DUF782 (HMM E-Value=8.4) 41 0.001 SB_58306| Best HMM Match : Sugar_tr (HMM E-Value=2.6e-05) 31 0.002 SB_29945| Best HMM Match : DUF125 (HMM E-Value=1.7) 40 0.003 SB_9157| Best HMM Match : Fumarate_red_C (HMM E-Value=1.8) 39 0.005 SB_20443| Best HMM Match : Sugar_tr (HMM E-Value=3.5) 38 0.007 SB_50140| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_31847| Best HMM Match : Sugar_tr (HMM E-Value=4.6e-05) 35 0.082 SB_30184| Best HMM Match : CBP4 (HMM E-Value=4.8) 34 0.14 SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) 31 1.3 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 29 3.1 SB_53649| Best HMM Match : FKBP_C (HMM E-Value=4.1e-05) 29 4.1 SB_16861| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_59345| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_58747| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.4 >SB_51145| Best HMM Match : RCSD (HMM E-Value=1.3) Length = 248 Score = 70.1 bits (164), Expect = 2e-12 Identities = 33/70 (47%), Positives = 45/70 (64%) Frame = +2 Query: 101 LYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFFGELNVLASWLPPIVFGLFPVLGIVA 280 LYV++ ELFPT+ RN MG S +R G+ LAPF +L + + LP + G L +A Sbjct: 24 LYVFSAELFPTMVRNSGMGLLSVISRVGAALAPFVVQLTRINAILPFALMGGLTFLAALA 83 Query: 281 CYFLPETKGK 310 C+FLPET+GK Sbjct: 84 CWFLPETRGK 93 >SB_18740| Best HMM Match : MFS_1 (HMM E-Value=1.1e-15) Length = 839 Score = 65.7 bits (153), Expect = 4e-11 Identities = 33/83 (39%), Positives = 52/83 (62%), Gaps = 5/83 (6%) Frame = +2 Query: 68 MTRKIVKRSTFL--YVYTTELFPTVARNMAMGASSTTTRAGSMLAPFF---GELNVLASW 232 M K+ + F+ YV+T EL+PT+ RN+ +G +ST R G ++AP+F GEL + + Sbjct: 412 MIGKVSVSNNFMTSYVFTVELYPTIIRNIGLGVASTMARVGGIVAPYFVLMGELPDVDNT 471 Query: 233 LPPIVFGLFPVLGIVACYFLPET 301 +P ++FG+ + VA FLPET Sbjct: 472 VPMVIFGVLGLAAGVAVLFLPET 494 >SB_1462| Best HMM Match : MFS_1 (HMM E-Value=0.042) Length = 277 Score = 65.7 bits (153), Expect = 4e-11 Identities = 33/91 (36%), Positives = 56/91 (61%), Gaps = 3/91 (3%) Frame = +2 Query: 95 TFLYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFF---GELNVLASWLPPIVFGLFPV 265 T +Y+ T+EL+PT RN A+G +T R G ++AP+F +L ++ +LP I+FG + Sbjct: 29 TTIYLITSELYPTTIRNTAIGTCATFARIGGLVAPYFIMLKDLPGVSLYLPVIIFGCLCI 88 Query: 266 LGIVACYFLPETKGKQLDDHLDES*SI*DHH 358 L +A +F+PET L ++E+ S D++ Sbjct: 89 LAAIAFFFIPETLKVPLAQSIEEAESRTDNY 119 >SB_1828| Best HMM Match : DUF938 (HMM E-Value=1.5) Length = 206 Score = 65.7 bits (153), Expect = 4e-11 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 2/90 (2%) Frame = +2 Query: 68 MTRKIVKRSTF--LYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFFGELNVLASWLPP 241 MT K +F +YVY ELFPTV RN+ MG S+ R GS AP+ LN + LP Sbjct: 48 MTAKFFVMVSFDAIYVYAAELFPTVIRNIGMGTSTAAARLGSFSAPYVVNLNRIHPLLPF 107 Query: 242 IVFGLFPVLGIVACYFLPETKGKQLDDHLD 331 + + +L + C LPETKG + +D Sbjct: 108 GIMAVKALLAGILCMTLPETKGMATAETMD 137 >SB_25976| Best HMM Match : RVT_1 (HMM E-Value=5.3e-22) Length = 1421 Score = 62.9 bits (146), Expect = 3e-10 Identities = 32/79 (40%), Positives = 46/79 (58%) Frame = +2 Query: 101 LYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFFGELNVLASWLPPIVFGLFPVLGIVA 280 +YVY++ELFPTV RN AMG S++ R GS APF + +P + L ++ + Sbjct: 783 VYVYSSELFPTVVRNTAMGTSTSAARIGSFAAPFTVYSQKVHPMMPFGIMALNALICGIL 842 Query: 281 CYFLPETKGKQLDDHLDES 337 C LPETK K L D + ++ Sbjct: 843 CMTLPETKDKPLPDTVKQT 861 >SB_11833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 636 Score = 62.9 bits (146), Expect = 3e-10 Identities = 32/79 (40%), Positives = 46/79 (58%) Frame = +2 Query: 101 LYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFFGELNVLASWLPPIVFGLFPVLGIVA 280 +YVY++ELFPTV RN AMG S++ R GS APF + +P + L ++ + Sbjct: 524 VYVYSSELFPTVVRNTAMGTSTSAARIGSFAAPFTVYSQKVHPMMPFGIMALNALICGIL 583 Query: 281 CYFLPETKGKQLDDHLDES 337 C LPETK K L D + ++ Sbjct: 584 CMTLPETKDKPLPDTVKQT 602 >SB_19693| Best HMM Match : Sugar_tr (HMM E-Value=0.0002) Length = 512 Score = 62.5 bits (145), Expect = 4e-10 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 3/82 (3%) Frame = +2 Query: 101 LYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFF---GELNVLASWLPPIVFGLFPVLG 271 +Y+ T ELFPTV RN AMG +S R G +L+PF +L L+ LP +FG+ + Sbjct: 392 IYIITGELFPTVIRNTAMGLASLFARVGGILSPFIVMVAQLPGLSITLPVTIFGVLALGS 451 Query: 272 IVACYFLPETKGKQLDDHLDES 337 VA +LPET + +DE+ Sbjct: 452 AVASLWLPETMNADMHQTIDEA 473 >SB_37980| Best HMM Match : 7tm_2 (HMM E-Value=5.3e-13) Length = 1297 Score = 62.1 bits (144), Expect = 5e-10 Identities = 29/37 (78%), Positives = 31/37 (83%), Gaps = 2/37 (5%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIFI--RVHYR 120 YTKIGTIQRRLAWPLRKDDTQ REAF IF + H+R Sbjct: 1057 YTKIGTIQRRLAWPLRKDDTQIREAFQIFFPAQTHFR 1093 >SB_57462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 61.3 bits (142), Expect = 8e-10 Identities = 28/76 (36%), Positives = 46/76 (60%) Frame = +2 Query: 101 LYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFFGELNVLASWLPPIVFGLFPVLGIVA 280 +Y+++ EL+PTV R + +G +S R G+M AP+ + L + P I+FG + + Sbjct: 28 IYIHSAELYPTVIRTIGVGFASLCARVGAMGAPYVADSTPLIA--PAIIFGGLSMTAGMV 85 Query: 281 CYFLPETKGKQLDDHL 328 +FLPET+G L DH+ Sbjct: 86 TFFLPETRGMPLPDHI 101 >SB_14272| Best HMM Match : Sugar_tr (HMM E-Value=0.0046) Length = 775 Score = 61.3 bits (142), Expect = 8e-10 Identities = 29/81 (35%), Positives = 49/81 (60%), Gaps = 3/81 (3%) Frame = +2 Query: 104 YVYTTELFPTVARNMAMGASSTTTRAGSMLAPF---FGELNVLASWLPPIVFGLFPVLGI 274 ++Y TELFPTV R+ A+G + T+R G ML P+ G+L ++P +FG+ ++G Sbjct: 660 FLYGTELFPTVVRSNAIGCGTMTSRLGGMLTPYIAMLGQLPNYGVYVPATIFGVLTLVGA 719 Query: 275 VACYFLPETKGKQLDDHLDES 337 + +LPET +L ++E+ Sbjct: 720 IMSLWLPETLFAKLSQTVEEA 740 >SB_58422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_57282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_55675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_53531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_51851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_51844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_49026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_47126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_42980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_41200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_39911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_39828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 44 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 72 >SB_38934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 15 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 43 Score = 55.2 bits (127), Expect = 5e-08 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REA F Sbjct: 57 YTKIGTIQRRLAWPLRKDDTQIREASKFF 85 >SB_34283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_29488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_28464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 27 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 55 >SB_23522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_19655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_18351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_17016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_15018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_13950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_12937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_12563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_9931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_5449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_59704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 122 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 150 >SB_58431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_54126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_45758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_44961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_44549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_36128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 52 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 80 >SB_35247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_34984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_34197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_32036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 52 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 80 >SB_28547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_26763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_26757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_26470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_24001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_23476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_23166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_19253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_13603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 52 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 80 >SB_13164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_11232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_7675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_4220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_1385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_57564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 60.1 bits (139), Expect = 2e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTK+GTIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKVGTIQRRLAWPLRKDDTQIREAFQIF 38 >SB_23705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 59.3 bits (137), Expect = 3e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKIGTIQRRLAWPLRKDDTQ REAF +F Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQMF 38 >SB_51293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 58.4 bits (135), Expect = 6e-09 Identities = 27/67 (40%), Positives = 40/67 (59%) Frame = +2 Query: 101 LYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFFGELNVLASWLPPIVFGLFPVLGIVA 280 +Y+YTTEL PT+ RN+++G S +R G ++AP+ LN LP +VFG+ + Sbjct: 174 VYIYTTELNPTLLRNLSLGVGSMMSRVGGIIAPYIVFLNDFMQNLPLVVFGVMAFSAGLI 233 Query: 281 CYFLPET 301 LPET Sbjct: 234 ALMLPET 240 >SB_3186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 58.0 bits (134), Expect = 8e-09 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHI 99 YTKIGTIQRRLAWPLRKDDTQ REAF I Sbjct: 10 YTKIGTIQRRLAWPLRKDDTQIREAFQI 37 >SB_7199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 57.2 bits (132), Expect = 1e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 16 YTKIGTIQRRLAWPLRKDDTQNREAFHIF 102 YTKI TIQRRLAWPLRKDDTQ REAF IF Sbjct: 10 YTKIETIQRRLAWPLRKDDTQIREAFQIF 38 >SB_4525| Best HMM Match : Sugar_tr (HMM E-Value=0.028) Length = 630 Score = 56.4 bits (130), Expect = 2e-08 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 3/82 (3%) Frame = +2 Query: 101 LYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFF---GELNVLASWLPPIVFGLFPVLG 271 +Y+ T EL+PTV RN A+G S R G +AP+F +L L+ P VFGL ++ Sbjct: 90 VYLITAELYPTVLRNSALGTGSLIGRIGGTIAPYFTMIAQLPGLSMTFPVTVFGLSAIIA 149 Query: 272 IVACYFLPETKGKQLDDHLDES 337 Y LPET ++ ++++ Sbjct: 150 GAMTYLLPETLFAKMHQTIEQT 171 Score = 56.4 bits (130), Expect = 2e-08 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 3/82 (3%) Frame = +2 Query: 101 LYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFF---GELNVLASWLPPIVFGLFPVLG 271 +Y+ T EL+PTV RN A+G S R G +AP+F +L L+ P VFGL ++ Sbjct: 495 VYLITAELYPTVLRNSALGTGSLIGRIGGTIAPYFTMIAQLPGLSMTFPVTVFGLSAIIA 554 Query: 272 IVACYFLPETKGKQLDDHLDES 337 Y LPET ++ ++++ Sbjct: 555 GAMTYLLPETLFAKMHQTIEQT 576 >SB_1829| Best HMM Match : 5TM-5TMR_LYT (HMM E-Value=3.3) Length = 172 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/78 (33%), Positives = 43/78 (55%) Frame = +2 Query: 101 LYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFFGELNVLASWLPPIVFGLFPVLGIVA 280 ++V+++ELFPTV RN+ MG SS + R G++ +PF L +P + + + + Sbjct: 56 IFVFSSELFPTVVRNIGMGTSSASGRLGAITSPFVIWLGRFHPAVPYAIMAVDAFIAGIL 115 Query: 281 CYFLPETKGKQLDDHLDE 334 C LPET + L+E Sbjct: 116 CMLLPETNNAPTAETLNE 133 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 53.6 bits (123), Expect = 2e-07 Identities = 27/84 (32%), Positives = 48/84 (57%), Gaps = 3/84 (3%) Frame = +2 Query: 95 TFLYVYTTELFPTVARNMAMGASSTTTRAGSMLAPF---FGELNVLASWLPPIVFGLFPV 265 T +Y+ T+E +PT+ RN A+G S R G+M+AP+ +L ++ +P I+FG V Sbjct: 996 TTVYLITSESYPTILRNTALGTGSLCGRLGAMIAPYVAMMAQLPSVSLTVPVIIFGGVAV 1055 Query: 266 LGIVACYFLPETKGKQLDDHLDES 337 + V ++PET + ++E+ Sbjct: 1056 VASVTSLWIPETHYAPMPQTIEEA 1079 >SB_12485| Best HMM Match : ATP-synt_C (HMM E-Value=3.9) Length = 126 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/80 (32%), Positives = 46/80 (57%), Gaps = 3/80 (3%) Frame = +2 Query: 107 VYTTELFPTVARNMAMGASSTTTRAGSMLAPF---FGELNVLASWLPPIVFGLFPVLGIV 277 +Y TELFPTV R+ A+ + +R G +L P+ G+L ++P +FG+ ++G + Sbjct: 10 LYGTELFPTVVRSNALACGTMISRLGVILTPYIAMLGQLPNYGMYVPATMFGVLTLVGAI 69 Query: 278 ACYFLPETKGKQLDDHLDES 337 +LPET +L ++E+ Sbjct: 70 MSLWLPETLFAKLSQTVEEA 89 >SB_51144| Best HMM Match : Sugar_tr (HMM E-Value=0.13) Length = 371 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/57 (42%), Positives = 33/57 (57%) Frame = +2 Query: 140 RNMAMGASSTTTRAGSMLAPFFGELNVLASWLPPIVFGLFPVLGIVACYFLPETKGK 310 RN MG S +R G+ LAPF +L + + LP + L +AC+FLPET+GK Sbjct: 284 RNSGMGLLSVISRVGAALAPFVVQLTRINAILPFALMSGLTFLAALACWFLPETRGK 340 >SB_29014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 48.4 bits (110), Expect = 6e-06 Identities = 20/36 (55%), Positives = 27/36 (75%) Frame = +2 Query: 95 TFLYVYTTELFPTVARNMAMGASSTTTRAGSMLAPF 202 T +Y+ TTELFPTV RN A+G ST R G+++AP+ Sbjct: 22 TAVYLITTELFPTVLRNTALGVGSTCARVGAIIAPY 57 >SB_53613| Best HMM Match : Sugar_tr (HMM E-Value=0.00012) Length = 466 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 3/56 (5%) Frame = +2 Query: 143 NMAMGASSTTTRAGSMLAPFF---GELNVLASWLPPIVFGLFPVLGIVACYFLPET 301 N A G ST R G+MLAP+ G+L + LP + G+ ++ VA Y++PET Sbjct: 364 NTAQGVGSTAARIGAMLAPYIAMSGQLPGTSVALPATICGVIALIAAVATYWIPET 419 >SB_896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 968 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 3/76 (3%) Frame = +2 Query: 140 RNMAMGASSTTTRAGSMLAPFFGELNVLASW---LPPIVFGLFPVLGIVACYFLPETKGK 310 RN+ MG S R G++L+PF L L + P +FG+ VL ++ +LPET Sbjct: 866 RNIGMGVGSMCARVGAILSPFIVMLAQLPGFSLTFPVSIFGVLAVLAAISSLWLPETLNT 925 Query: 311 QLDDHLDES*SI*DHH 358 L ++E +H+ Sbjct: 926 SLPQTIEEMERTKEHY 941 >SB_56587| Best HMM Match : DUF782 (HMM E-Value=8.4) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 3/53 (5%) Frame = +2 Query: 152 MGASSTTTRAGSMLAPFF---GELNVLASWLPPIVFGLFPVLGIVACYFLPET 301 MG S + R ++LAP+ G+L L+ LP +FG+ ++G +A Y+LPET Sbjct: 1 MGMGSCSARIAAILAPYIVMTGQLPGLSLALPVTIFGVCAIVGGIATYWLPET 53 >SB_58306| Best HMM Match : Sugar_tr (HMM E-Value=2.6e-05) Length = 457 Score = 31.5 bits (68), Expect(2) = 0.002 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = +2 Query: 140 RNMAMGASSTTTRAGSMLAPF 202 RN+A+GA ST+ R G++LAP+ Sbjct: 315 RNIALGAGSTSARIGAILAPY 335 Score = 27.5 bits (58), Expect(2) = 0.002 Identities = 14/50 (28%), Positives = 29/50 (58%) Frame = +2 Query: 209 ELNVLASWLPPIVFGLFPVLGIVACYFLPETKGKQLDDHLDES*SI*DHH 358 +L L+ LP +FG+ +L + Y+LPET ++ ++E+ + D++ Sbjct: 370 QLPGLSLALPVTIFGVVALLNGMLSYWLPETLFAKMHQTIEETEAAQDYY 419 >SB_29945| Best HMM Match : DUF125 (HMM E-Value=1.7) Length = 608 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 2/68 (2%) Frame = +2 Query: 119 ELFPTVARNMAMGASSTTTRAGSMLAPFFGELNVLASWLPPI-VFGLFPVLGIVACYFLP 295 E++PT R +G + R G ++AP ++ +S I V LF L V CYFLP Sbjct: 474 EVYPTAFRATGLGLMNGIGRIGGVIAPLISQVLADSSMNAAIGVLLLFTALCTVTCYFLP 533 Query: 296 -ETKGKQL 316 ET+ ++L Sbjct: 534 IETRQREL 541 >SB_9157| Best HMM Match : Fumarate_red_C (HMM E-Value=1.8) Length = 294 Score = 38.7 bits (86), Expect = 0.005 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 6/85 (7%) Frame = +2 Query: 101 LYVYTTELFPTVARNMAMGASST--TTRAGSMLAPFF----GELNVLASWLPPIVFGLFP 262 +Y+YT+EL+PTV R G + R ++ P + +L ++ LP ++FG+ Sbjct: 175 IYLYTSELYPTVIRLACQGNTRVVRAVRIACVIIPVYTMLQAQLPSVSITLPIVIFGVCS 234 Query: 263 VLGIVACYFLPETKGKQLDDHLDES 337 + V +LPET + ++E+ Sbjct: 235 LAAGVMSLWLPETLRTTMQQTIEET 259 >SB_20443| Best HMM Match : Sugar_tr (HMM E-Value=3.5) Length = 563 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 104 YVYTTELFPTVARNMAMGASSTTTRAGSMLAPF 202 YVYT E++PT R + +GA + R G ML P+ Sbjct: 528 YVYTPEVYPTAIRGIGLGACNGIARIGCMLTPY 560 >SB_50140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 35.1 bits (77), Expect = 0.062 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +2 Query: 152 MGASSTTTRAGSMLAPFFGELNVLASWLPPIVFGLFPVLGIVACYFLPETKGK 310 MG SS R G+++ PF L + LP + +F + + C +PET+ K Sbjct: 1 MGTSSAFARVGAVVKPFVVWLVRIHVLLPYPIMAVFATVAAILCLTIPETRDK 53 >SB_31847| Best HMM Match : Sugar_tr (HMM E-Value=4.6e-05) Length = 549 Score = 34.7 bits (76), Expect = 0.082 Identities = 18/53 (33%), Positives = 32/53 (60%) Frame = +2 Query: 101 LYVYTTELFPTVARNMAMGASSTTTRAGSMLAPFFGELNVLASWLPPIVFGLF 259 +Y+ +E+FPT R+ A+G ST R G+++A G +++L S P + +F Sbjct: 367 IYLIGSEVFPTTIRSTALGMCSTFQRCGALVA---GYVSMLVSKNPLSICSIF 416 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +2 Query: 200 FFGELNVLASWLPPIVFGLFPV-LGIVACYFLPETKGKQLDDHLDES 337 F +L L+ +LP ++GLF + G++ F+PET L ++E+ Sbjct: 470 FQSQLPGLSIYLPVTIYGLFAIAAGVLFAIFIPETLHATLAQTIEEA 516 >SB_30184| Best HMM Match : CBP4 (HMM E-Value=4.8) Length = 123 Score = 33.9 bits (74), Expect = 0.14 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 4/69 (5%) Frame = +2 Query: 143 NMAMGASSTTTRAGSMLAPFFGEL----NVLASWLPPIVFGLFPVLGIVACYFLPETKGK 310 N +G SS R G +LAP+ L NV ++ P ++FG+ V + +LPET Sbjct: 2 NTGIGVSSMLARFGGILAPYIVLLADVPNVNKNF-PLVIFGVLAVAAGILALWLPETLFS 60 Query: 311 QLDDHLDES 337 Q+ ++++ Sbjct: 61 QMSQTVEQA 69 >SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19) Length = 1211 Score = 30.7 bits (66), Expect = 1.3 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 390 KHIFLYIKLATRPCFASETVIYY*FLHYLMDVIIHINLPL-QSLYLLKKP 536 K F ++ L+T+PCF S T+ L ++HI PL Q+L L +P Sbjct: 537 KPCFTFLTLSTKPCFTSLTLSPKPCFTPLTQALLHIPHPLNQALLLTLQP 586 >SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) Length = 128 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = +1 Query: 46 LAWPLRKDDTQNREAFHIFIRVH--YR-AVPNGGSEY 147 L+W L +DD+ +R I+I+++ YR P GG+ Y Sbjct: 15 LSWKLERDDSYSRGVSDIYIKIYQAYRYRRPRGGARY 51 >SB_53649| Best HMM Match : FKBP_C (HMM E-Value=4.1e-05) Length = 639 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -1 Query: 261 GNSPNTMGGSQEASTFSSPKNGANIEPARVVVDEAPMAIFRATV 130 G + G E+ T+++PK +PA +AP +F A V Sbjct: 13 GQDRASFTGGNESLTYTAPKQPKTEKPAAQASSDAPAVVFAAAV 56 >SB_16861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2214 Score = 28.7 bits (61), Expect = 5.4 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 464 SPLFNGCHYTYKP 502 +PLF+GCHY Y P Sbjct: 530 NPLFDGCHYNYLP 542 >SB_59345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1031 Score = 28.3 bits (60), Expect = 7.1 Identities = 25/90 (27%), Positives = 36/90 (40%), Gaps = 1/90 (1%) Frame = +1 Query: 67 DDTQNREAFHIFIRVHYRAVPNGGSEYGHGRFIHHHASRLYVGT-ILWRAKCTGFLATTH 243 DDT+N E H FI + + N G + A+ V T + R T F + H Sbjct: 264 DDTENNEEEHTFI-FNVKDHSNKVLNNPKGMLVDTGATSHIVTTDTITRIDGT-FKPSEH 321 Query: 244 CIRTVSSTRNRGLLFPSRDERETARRSSGR 333 C+ TR R + D T + +GR Sbjct: 322 CMELADGTRTRNIAVKRGDAMVTLKDVNGR 351 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 270 PSTGNSPNTMGGSQEASTFSSPKNGANIEPARVVV 166 P T N P T ++E S S+P+NGA E A + + Sbjct: 130 PRTRNYPRTRNNTEE-SPISTPRNGAAAEGAHLAL 163 >SB_58747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 27.9 bits (59), Expect = 9.4 Identities = 15/28 (53%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +2 Query: 95 TFLYVYTTELFPTVARNM-AMGASSTTT 175 T Y+ TELFPTV R M A+ A S T Sbjct: 22 TTTYILVTELFPTVIRCMRALNAISVAT 49 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,047,774 Number of Sequences: 59808 Number of extensions: 498192 Number of successful extensions: 1599 Number of sequences better than 10.0: 91 Number of HSP's better than 10.0 without gapping: 1344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1581 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -