BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0418 (753 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 2.5 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 23 7.7 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.0 bits (52), Expect = 2.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 609 TKSLSLSLYPYVCLNL*NYATHFDAV 532 T S++LS P + LN NY FDAV Sbjct: 317 THSMTLSWAPPIRLNPINYKISFDAV 342 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 23.4 bits (48), Expect = 7.7 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = -1 Query: 669 TRFKFQKYSKK**LITT*YKTKSLSLSLYPYVCLNL*NYATHFDAV-FLIDRVIEEV 502 T +F+KY K + T K+ S YP + NL T+ D F +D V E V Sbjct: 202 TDSEFRKYGNKAFELNTMIMMKTFLASSYPTLVRNLHMKITYNDVERFFLDIVKETV 258 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 790,908 Number of Sequences: 2352 Number of extensions: 16854 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -