BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0416 (731 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription fact... 26 1.4 L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 24 4.2 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 24 4.2 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 24 4.2 AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-tran... 23 7.4 >AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription factor protein. Length = 391 Score = 25.8 bits (54), Expect = 1.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 702 KQLRIDRQDEGIPDVKSLLEFIEITNINDAAKVQR 598 K+ R+ R +E IP + LLE EIT + ++R Sbjct: 157 KRTRVIRTEEYIPTQEELLEEAEITERENIKSLER 191 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 729 VLIFVALAAKQLRIDRQDEGIPD 661 +L+ V A+KQ+ +D+Q +GI D Sbjct: 36 LLLQVQAASKQIAVDKQYKGIVD 58 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 729 VLIFVALAAKQLRIDRQDEGIPD 661 +L+ V A+KQ+ +D+Q +GI D Sbjct: 36 LLLQVQAASKQIAVDKQYKGIVD 58 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -3 Query: 729 VLIFVALAAKQLRIDRQDEGIPD 661 +L+ V A+KQ+ +D+Q +GI D Sbjct: 36 LLLQVQAASKQIAVDKQYKGIVD 58 >AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-transferase E4 protein. Length = 225 Score = 23.4 bits (48), Expect = 7.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 208 HFFSKIAVMQRSNIYLKKNIFHGLTENLRKTIEN 107 HF S + + R YL+ +++G TE ++ I+N Sbjct: 103 HFDSGV-LFARFRFYLEPILYYGATETPQEKIDN 135 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 637,409 Number of Sequences: 2352 Number of extensions: 12130 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -