BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0416 (731 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 27 0.24 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 22 5.2 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 21 9.0 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 21 9.0 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 9.0 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 9.0 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 9.0 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 9.0 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 9.0 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 21 9.0 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 9.0 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 9.0 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 9.0 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 9.0 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 9.0 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 9.0 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 9.0 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 9.0 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 9.0 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 9.0 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 9.0 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 9.0 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 9.0 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 26.6 bits (56), Expect = 0.24 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 3/70 (4%) Frame = -2 Query: 313 FHKI*QNFLVNH---VESLYKVLW*INQTSLADSLSYFHFFSKIAVMQRSNIYLKKNIFH 143 F KI +N L + V + YK + Q DS+S++H ++ + +++ ++ LKK F Sbjct: 426 FSKIAENLLEKNWLPVHTSYKSGLNLEQEK-KDSISHYHLYTNLTALRKRDV-LKKGNF- 482 Query: 142 GLTENLRKTI 113 E L KT+ Sbjct: 483 -TIEILNKTV 491 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = -1 Query: 614 PLRFKEISISISNACSDIQT 555 P FKEI + + ++CS++ + Sbjct: 99 PEAFKEIGVEMIDSCSNVDS 118 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 9 NREYKEKDRRYEKL 22 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 231 NREYKEKDRRYEKL 244 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 242 NREYKEKDRRYEKL 255 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 242 NREYKEKDRRYEKL 255 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 137 NRKFKENDRKLEMI 96 NR++KE DR+ E + Sbjct: 242 NREYKEKDRRYEKL 255 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,815 Number of Sequences: 438 Number of extensions: 3380 Number of successful extensions: 31 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -