BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0415 (597 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56000.1 68418.m06988 heat shock protein 81-4 (HSP81-4) nearl... 86 1e-17 At5g56030.1 68418.m06991 heat shock protein 81-2 (HSP81-2) nearl... 86 2e-17 At5g56010.1 68418.m06989 heat shock protein, putative strong sim... 86 2e-17 At4g24190.2 68417.m03473 shepherd protein (SHD) / clavata format... 84 6e-17 At4g24190.1 68417.m03472 shepherd protein (SHD) / clavata format... 84 6e-17 At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / hea... 84 8e-17 At3g07770.1 68416.m00947 heat shock protein-related strong simil... 81 7e-16 At2g04030.2 68415.m00372 heat shock protein, putative strong sim... 78 5e-15 At2g04030.1 68415.m00371 heat shock protein, putative strong sim... 77 7e-15 At1g69100.1 68414.m07907 aspartyl protease family protein contai... 29 1.8 At3g05990.1 68416.m00684 leucine-rich repeat family protein cont... 29 3.1 At2g46960.2 68415.m05866 cytochrome P450 family protein similar ... 28 4.1 At2g46960.1 68415.m05865 cytochrome P450 family protein similar ... 28 4.1 At2g43940.1 68415.m05461 thiol methyltransferase, putative simil... 28 4.1 At4g27910.1 68417.m04006 PHD finger protein-related / SET domain... 27 9.5 At3g17850.1 68416.m02275 protein kinase, putative similar to IRE... 27 9.5 At3g15340.1 68416.m01936 expressed protein 27 9.5 At2g46370.2 68415.m05771 auxin-responsive GH3 family protein sim... 27 9.5 At2g46370.1 68415.m05770 auxin-responsive GH3 family protein sim... 27 9.5 At2g34060.1 68415.m04170 peroxidase, putative similar to peroxid... 27 9.5 >At5g56000.1 68418.m06988 heat shock protein 81-4 (HSP81-4) nearly identical to heat shock protein hsp81.4 [Arabidopsis thaliana] GI:1906828; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 699 Score = 86.2 bits (204), Expect = 1e-17 Identities = 41/92 (44%), Positives = 65/92 (70%), Gaps = 3/92 (3%) Frame = +1 Query: 1 IIKKKLVRKVLDMLKKIPD--DEYEHFWKEYSTNIKLGVMEDPSNRSRLAKLLRFHSSHS 174 +I+K LV+K L++ +I + ++Y F++ +S N+KLG+ ED NR+++A+LLR+HS+ S Sbjct: 382 VIRKNLVKKCLELFFEIAENKEDYNKFYEAFSKNLKLGIHEDSQNRTKIAELLRYHSTKS 441 Query: 175 -EEKTFLSDYVKRMKPKQHHIYYIAGSSRAEV 267 +E T L DYV RMK Q+ I+YI G S+ V Sbjct: 442 GDELTSLKDYVTRMKEGQNEIFYITGESKKAV 473 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/49 (42%), Positives = 33/49 (67%) Frame = +2 Query: 446 VEKSPFAERLVSRGYEVLYLTEAVDEYCLSSLPEYDGHKFQNIAQGNIR 592 VE SPF E+L +GYEVLY+ +A+DEY + L E++G K + + ++ Sbjct: 473 VENSPFLEKLKKKGYEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLK 521 >At5g56030.1 68418.m06991 heat shock protein 81-2 (HSP81-2) nearly identical to SP|P55737 Heat shock protein 81-2 (HSP81-2) {Arabidopsis thaliana} Length = 699 Score = 85.8 bits (203), Expect = 2e-17 Identities = 41/92 (44%), Positives = 65/92 (70%), Gaps = 3/92 (3%) Frame = +1 Query: 1 IIKKKLVRKVLDMLKKIPD--DEYEHFWKEYSTNIKLGVMEDPSNRSRLAKLLRFHSSHS 174 +I+K LV+K L++ +I + ++Y F++ +S N+KLG+ ED NR+++A+LLR+HS+ S Sbjct: 382 VIRKNLVKKCLELFFEIAENKEDYNKFYEAFSKNLKLGIHEDSQNRTKIAELLRYHSTKS 441 Query: 175 -EEKTFLSDYVKRMKPKQHHIYYIAGSSRAEV 267 +E T L DYV RMK Q+ I+YI G S+ V Sbjct: 442 GDELTSLKDYVTRMKEGQNDIFYITGESKKAV 473 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/49 (40%), Positives = 32/49 (65%) Frame = +2 Query: 446 VEKSPFAERLVSRGYEVLYLTEAVDEYCLSSLPEYDGHKFQNIAQGNIR 592 VE SPF E+L +G EVLY+ +A+DEY + L E++G K + + ++ Sbjct: 473 VENSPFLEKLKKKGIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLK 521 >At5g56010.1 68418.m06989 heat shock protein, putative strong similarity to SP|P55737 Heat shock protein 81-2 (HSP81-2) {Arabidopsis thaliana}; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 699 Score = 85.8 bits (203), Expect = 2e-17 Identities = 41/92 (44%), Positives = 65/92 (70%), Gaps = 3/92 (3%) Frame = +1 Query: 1 IIKKKLVRKVLDMLKKIPD--DEYEHFWKEYSTNIKLGVMEDPSNRSRLAKLLRFHSSHS 174 +I+K LV+K L++ +I + ++Y F++ +S N+KLG+ ED NR+++A+LLR+HS+ S Sbjct: 382 VIRKNLVKKCLELFFEIAENKEDYNKFYEAFSKNLKLGIHEDSQNRTKIAELLRYHSTKS 441 Query: 175 -EEKTFLSDYVKRMKPKQHHIYYIAGSSRAEV 267 +E T L DYV RMK Q+ I+YI G S+ V Sbjct: 442 GDELTSLKDYVTRMKEGQNDIFYITGESKKAV 473 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/49 (40%), Positives = 32/49 (65%) Frame = +2 Query: 446 VEKSPFAERLVSRGYEVLYLTEAVDEYCLSSLPEYDGHKFQNIAQGNIR 592 VE SPF E+L +G EVLY+ +A+DEY + L E++G K + + ++ Sbjct: 473 VENSPFLEKLKKKGIEVLYMVDAIDEYAIGQLKEFEGKKLVSATKEGLK 521 >At4g24190.2 68417.m03473 shepherd protein (SHD) / clavata formation protein, putative nearly identical to SHEPHERD [Arabidopsis thaliana] GI:19570872; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 823 Score = 84.2 bits (199), Expect = 6e-17 Identities = 48/113 (42%), Positives = 69/113 (61%), Gaps = 25/113 (22%) Frame = +1 Query: 4 IKKKLVRKVLDMLKKI----PDD--------------------EYEHFWKEYSTNIKLGV 111 IKKKL+RK LDM++K+ PD+ +Y FW E+ ++KLG+ Sbjct: 467 IKKKLIRKALDMIRKLAEEDPDEIHDDEKKDVEKSGENDEKKGQYTKFWNEFGKSVKLGI 526 Query: 112 MEDPSNRSRLAKLLRFHSSHSEEK-TFLSDYVKRMKPKQHHIYYIAGSSRAEV 267 +ED +NR+RLAKLLRF ++ S+ K T L Y+KRMK Q I+YI GSS+ ++ Sbjct: 527 IEDAANRNRLAKLLRFETTKSDGKLTSLDQYIKRMKKSQKDIFYITGSSKEQL 579 Score = 63.3 bits (147), Expect = 1e-10 Identities = 25/54 (46%), Positives = 40/54 (74%) Frame = +2 Query: 431 SRRLQVEKSPFAERLVSRGYEVLYLTEAVDEYCLSSLPEYDGHKFQNIAQGNIR 592 S + Q+EKSPF ERL+ +GYEV++ T+ VDEY + L +Y+ KFQN+++ ++ Sbjct: 574 SSKEQLEKSPFLERLIKKGYEVIFFTDPVDEYLMQYLMDYEDKKFQNVSKEGLK 627 >At4g24190.1 68417.m03472 shepherd protein (SHD) / clavata formation protein, putative nearly identical to SHEPHERD [Arabidopsis thaliana] GI:19570872; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 823 Score = 84.2 bits (199), Expect = 6e-17 Identities = 48/113 (42%), Positives = 69/113 (61%), Gaps = 25/113 (22%) Frame = +1 Query: 4 IKKKLVRKVLDMLKKI----PDD--------------------EYEHFWKEYSTNIKLGV 111 IKKKL+RK LDM++K+ PD+ +Y FW E+ ++KLG+ Sbjct: 467 IKKKLIRKALDMIRKLAEEDPDEIHDDEKKDVEKSGENDEKKGQYTKFWNEFGKSVKLGI 526 Query: 112 MEDPSNRSRLAKLLRFHSSHSEEK-TFLSDYVKRMKPKQHHIYYIAGSSRAEV 267 +ED +NR+RLAKLLRF ++ S+ K T L Y+KRMK Q I+YI GSS+ ++ Sbjct: 527 IEDAANRNRLAKLLRFETTKSDGKLTSLDQYIKRMKKSQKDIFYITGSSKEQL 579 Score = 63.3 bits (147), Expect = 1e-10 Identities = 25/54 (46%), Positives = 40/54 (74%) Frame = +2 Query: 431 SRRLQVEKSPFAERLVSRGYEVLYLTEAVDEYCLSSLPEYDGHKFQNIAQGNIR 592 S + Q+EKSPF ERL+ +GYEV++ T+ VDEY + L +Y+ KFQN+++ ++ Sbjct: 574 SSKEQLEKSPFLERLIKKGYEVIFFTDPVDEYLMQYLMDYEDKKFQNVSKEGLK 627 >At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / heat shock protein 83 (HSP83) nearly identical to SP|P27323 Heat shock protein 81-1 (HSP81-1) (Heat shock protein 83) {Arabidopsis thaliana}; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 705 Score = 83.8 bits (198), Expect = 8e-17 Identities = 40/92 (43%), Positives = 61/92 (66%), Gaps = 3/92 (3%) Frame = +1 Query: 1 IIKKKLVRKVLDMLKKIPD--DEYEHFWKEYSTNIKLGVMEDPSNRSRLAKLLRFHSSHS 174 +I+K LV+K ++M +I + ++Y F++ +S N+KLG+ ED NR ++A LLR+HS+ S Sbjct: 388 VIRKNLVKKCIEMFNEIAENKEDYTKFYEAFSKNLKLGIHEDSQNRGKIADLLRYHSTKS 447 Query: 175 -EEKTFLSDYVKRMKPKQHHIYYIAGSSRAEV 267 +E T DYV RMK Q I+YI G S+ V Sbjct: 448 GDEMTSFKDYVTRMKEGQKDIFYITGESKKAV 479 Score = 59.3 bits (137), Expect = 2e-09 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = +2 Query: 446 VEKSPFAERLVSRGYEVLYLTEAVDEYCLSSLPEYDGHKFQNIAQGNIR 592 VE SPF ERL RGYEVLY+ +A+DEY + L EYDG K + + ++ Sbjct: 479 VENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLK 527 >At3g07770.1 68416.m00947 heat shock protein-related strong similarity to heat-shock protein [Secale cereale] GI:556673; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 803 Score = 80.6 bits (190), Expect = 7e-16 Identities = 42/90 (46%), Positives = 57/90 (63%), Gaps = 5/90 (5%) Frame = +1 Query: 1 IIKKKLVRKVLDMLKKIP----DDEYEHFWKEYSTNIKLGVMEDPSNRSRLAKLLRFHSS 168 I+KK+LVRK DM+ I ++YE FW + ++KLG +ED N R+A LLRF SS Sbjct: 475 IMKKRLVRKAFDMILGISLSENREDYEKFWDNFGKHLKLGCIEDRENHKRIAPLLRFFSS 534 Query: 169 HSE-EKTFLSDYVKRMKPKQHHIYYIAGSS 255 SE + L +YV+ MKP+Q IY+IA S Sbjct: 535 QSENDMISLDEYVENMKPEQKAIYFIASDS 564 Score = 41.5 bits (93), Expect = 4e-04 Identities = 17/47 (36%), Positives = 30/47 (63%) Frame = +2 Query: 449 EKSPFAERLVSRGYEVLYLTEAVDEYCLSSLPEYDGHKFQNIAQGNI 589 + +PF E+++ +G EVLYL E +DE + SL Y F +I++ ++ Sbjct: 569 KNAPFLEKMLEKGLEVLYLVEPIDEVAVQSLKAYKEKDFVDISKEDL 615 >At2g04030.2 68415.m00372 heat shock protein, putative strong similarity to heat shock protein [Arabidopsis thaliana] GI:1906830; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 777 Score = 77.8 bits (183), Expect = 5e-15 Identities = 38/87 (43%), Positives = 56/87 (64%), Gaps = 2/87 (2%) Frame = +1 Query: 1 IIKKKLVRKVLDMLKKIPDDEY-EHFWKEYSTNIKLGVMEDPSNRSRLAKLLRFHSSHSE 177 I++K+L+RK DM+++I + E E FW+ + +KLG +ED N R+ LLRF SS +E Sbjct: 452 IMRKRLIRKTFDMIQEISESENKEKFWENFGRFLKLGCIEDTGNHKRITPLLRFFSSKNE 511 Query: 178 EK-TFLSDYVKRMKPKQHHIYYIAGSS 255 E+ T L DY++ M Q IYY+A S Sbjct: 512 EELTSLDDYIENMGENQKAIYYLATDS 538 Score = 41.9 bits (94), Expect = 3e-04 Identities = 17/47 (36%), Positives = 30/47 (63%) Frame = +2 Query: 449 EKSPFAERLVSRGYEVLYLTEAVDEYCLSSLPEYDGHKFQNIAQGNI 589 + +PF E+L+ + EVLYL E +DE + +L Y KF +I++ ++ Sbjct: 543 KSAPFLEKLIQKDIEVLYLVEPIDEVAIQNLQTYKEKKFVDISKEDL 589 >At2g04030.1 68415.m00371 heat shock protein, putative strong similarity to heat shock protein [Arabidopsis thaliana] GI:1906830; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 780 Score = 77.4 bits (182), Expect = 7e-15 Identities = 38/90 (42%), Positives = 57/90 (63%), Gaps = 5/90 (5%) Frame = +1 Query: 1 IIKKKLVRKVLDMLKKIPDDE----YEHFWKEYSTNIKLGVMEDPSNRSRLAKLLRFHSS 168 I++K+L+RK DM+++I + E Y+ FW+ + +KLG +ED N R+ LLRF SS Sbjct: 452 IMRKRLIRKTFDMIQEISESENKEDYKKFWENFGRFLKLGCIEDTGNHKRITPLLRFFSS 511 Query: 169 HSEEK-TFLSDYVKRMKPKQHHIYYIAGSS 255 +EE+ T L DY++ M Q IYY+A S Sbjct: 512 KNEEELTSLDDYIENMGENQKAIYYLATDS 541 Score = 41.9 bits (94), Expect = 3e-04 Identities = 17/47 (36%), Positives = 30/47 (63%) Frame = +2 Query: 449 EKSPFAERLVSRGYEVLYLTEAVDEYCLSSLPEYDGHKFQNIAQGNI 589 + +PF E+L+ + EVLYL E +DE + +L Y KF +I++ ++ Sbjct: 546 KSAPFLEKLIQKDIEVLYLVEPIDEVAIQNLQTYKEKKFVDISKEDL 592 >At1g69100.1 68414.m07907 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 343 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -1 Query: 141 KTGAVAGIFHHPELDVGGVLLPEVFVFIVRN 49 +TG+V GI ++VGGV++ +F+ RN Sbjct: 110 ETGSVVGILAQDNVNVGGVVIKSQDLFLARN 140 >At3g05990.1 68416.m00684 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leaf senescence-associated receptor-like protein kinase [Phaseolus vulgaris] gi|9837280|gb|AAG00510 Length = 517 Score = 28.7 bits (61), Expect = 3.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +1 Query: 46 KIPDDEYEHFWKEYSTN 96 + PDD+++ FW+ YS N Sbjct: 211 RFPDDQFDRFWEPYSLN 227 >At2g46960.2 68415.m05866 cytochrome P450 family protein similar to cytochrome P450 72A1 (SP:Q05047) [Catharanthus roseus]; contains Pfam profile: PF00067: Cytochrome P450; supported by cDNA: gi_13605860_gb_AF367329.1_AF367329 Length = 519 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 79 KEYSTNIKLGVMEDPSNRSRLAKLLRFHS 165 +E S NIKLG +E P + + LL+ HS Sbjct: 395 REASVNIKLGDLEIPKGTTVVIPLLKMHS 423 >At2g46960.1 68415.m05865 cytochrome P450 family protein similar to cytochrome P450 72A1 (SP:Q05047) [Catharanthus roseus]; contains Pfam profile: PF00067: Cytochrome P450; supported by cDNA: gi_13605860_gb_AF367329.1_AF367329 Length = 403 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 79 KEYSTNIKLGVMEDPSNRSRLAKLLRFHS 165 +E S NIKLG +E P + + LL+ HS Sbjct: 279 REASVNIKLGDLEIPKGTTVVIPLLKMHS 307 >At2g43940.1 68415.m05461 thiol methyltransferase, putative similar to thiol methyltransferase 2 GI:14583121 from [Brassica oleracea] Length = 226 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -3 Query: 229 GVAWASCASRSLTGRSSPPNGKSGTAAAWQDGSGCWDLPSP 107 G A + +SR L R N G +W+ G+ WDL P Sbjct: 5 GKATSLQSSRDLFHRLMSENSSGGWEKSWEAGATPWDLGKP 45 >At4g27910.1 68417.m04006 PHD finger protein-related / SET domain-containing protein (TX4) nearly identical over 285 amino acids to trithorax 4 [Arabidopsis thaliana] GI:16118405; contains Pfam profiles PF00856: SET domain, PF00855: PWWP domain; identical to cDNA trithorax 4 (TX4) partial cds GI:16118404 Length = 1027 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 88 STNIKLGVMEDPSNRSRLAKLLRFHSSHSEE 180 +TN+K ++ S S L K RFH H++E Sbjct: 154 ATNLKSKELDRKSKYSALCKEERFHEQHNDE 184 >At3g17850.1 68416.m02275 protein kinase, putative similar to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783; contains protein kinase domain Pfam:PF00069 Length = 1296 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -3 Query: 265 PQRGWSPRCSRCGVAWASCASRSLTGRSSPPNGKSG 158 P R SP G + AS S TGRS +G+SG Sbjct: 214 PPRSLSPTLPPSGSRLQNVASSSGTGRSEMSSGRSG 249 >At3g15340.1 68416.m01936 expressed protein Length = 487 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 154 RFHSSHSEEKTFLSDYVKRMKP 219 RF + +++K F DYVKR+ P Sbjct: 320 RFMTQWNDDKAFRDDYVKRISP 341 >At2g46370.2 68415.m05771 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 575 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 4/34 (11%) Frame = +1 Query: 64 YEHFWKEYSTNIKLGVMED----PSNRSRLAKLL 153 +E W+E T+IK GV+ + PS R+ ++KLL Sbjct: 234 FEQVWEEIVTDIKDGVLSNRITVPSVRTAMSKLL 267 >At2g46370.1 68415.m05770 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 575 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 4/34 (11%) Frame = +1 Query: 64 YEHFWKEYSTNIKLGVMED----PSNRSRLAKLL 153 +E W+E T+IK GV+ + PS R+ ++KLL Sbjct: 234 FEQVWEEIVTDIKDGVLSNRITVPSVRTAMSKLL 267 >At2g34060.1 68415.m04170 peroxidase, putative similar to peroxidase ATP20a {Arabidopsis thaliana} GP|9757794|dbj|BAB08292 Length = 346 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 430 RSAPAGNIPPNIFNINRT*SVKIKIFAS 347 + + A N+PPNI N T IK+FAS Sbjct: 170 KRSTAKNVPPNIPRSNSTVDQLIKLFAS 197 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,473,078 Number of Sequences: 28952 Number of extensions: 259406 Number of successful extensions: 896 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -